KEGG   Cavenderia fasciculata (cellular slime mold): DFA_01730Help
Entry
DFA_01730         CDS       T02668                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00010  Glycolysis / Gluconeogenesis
dfa00562  Inositol phosphate metabolism
dfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DFA_01730
   00562 Inositol phosphate metabolism
    DFA_01730
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     DFA_01730
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     DFA_01730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 14873517
NCBI-ProteinID: XP_004359695
UniProt: F4PUC9
Position
Unknown
AA seq 520 aa AA seqDB search
MNSNSNIFIQLCCCNIAFVQCRPSSSSSSSTSSSSSSSSSTTSSSSSSSSSEETFNIKQH
LSTNTPYWIPEQSKGSPNPPAQCTLQRIDMVARHGSRMPVESSIYDIIDLVQEIKQYSSS
IAPQYNWIVNWTVPYPTTDSGLLIFQGELEHYEIAKRMLTRFPDNFPAYSPNTYNTSCTV
VSRTCISANSFLYGAFEGTGGLGSSNYQPTFTWTASANEDYLLRFFDTCQTYKDLPVNTQ
KDQFQANVFPNISTKVAERLGLQDVFDISPSGIATIFSMCAYEISIDNITNQWCSLFDPS
DIEAWEYSQDLSNYWRKSYGIPINYQISSLLLQDMVQYFDQFGHAETIIPFVSLLGLYKD
DYQITANLSQEQIQSRLFRTSVISPYAANVALLFYDCGDNNYKLRVDHNEIATLIPGCDD
IYCDYTIFKQVFSDALTTFSWDKTCAAGDSSDDTPLYRSDKEWKILMSIFVPLSAIVGLL
LGLFLPAIFRKVTSDTREYQSLNHNNAGLVKIWTCIVSQS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaatagtaatatttttattcagctttgttgttgtaatattgcttttgtacaa
tgtagaccttcttcttcttcctcttcctctacttcctcttcttcatcatcttcgtcgtct
actacttcatcgtcttcttcatcatcatcatcagaggaaacatttaatattaaacaacat
ttatcaaccaacacaccttactggataccagaacaatccaagggatcgcccaacccacca
gcacaatgcacattacagagaattgatatggttgcaagacacggtagtagaatgccggta
gagtcatccatctatgacattattgacttggtgcaagagattaagcaatactcgagctcg
attgcaccccagtacaactggattgtcaattggactgtaccatacccaaccactgactcg
ggactcctcatctttcaaggagagttggaacactacgaaattgccaaaagaatgttgacg
aggttcccagataatttcccggcctactcaccaaacacctacaacacttcgtgtacagtg
gtcagccgtacgtgcatctctgccaattcattcctctatggcgcctttgaaggtactggt
ggtctcgggtcatccaactaccaaccaacctttacatggactgcttcggccaatgaagac
taccttttaagattctttgacacttgtcaaacctataaggacttgcctgtcaacacccaa
aaggatcaattccaggcaaacgtctttccaaacatctcgaccaaggttgctgagcgacta
ggtctacaagacgtgtttgatatttctccatcgggtattgccaccatattttcaatgtgt
gcctatgaaatctcgattgataacattaccaatcaatggtgcagtcttttcgatccatcc
gatattgaagcttgggaatattctcaagatttatcaaattattggcgtaaaagttatggt
attccaattaattatcaaattagttctttattattacaagatatggtacaatattttgat
caatttggtcatgccgaaactatcattccttttgtatcattgttgggattgtataaagac
gattaccaaataacagccaatctttctcaagaacaaattcaaagtagactattccgtaca
agtgtcatttcaccatatgcagcaaatgttgctttattattctatgattgtggtgataat
aattataaattaagagttgatcataatgaaattgcaacattgattccaggttgtgatgat
atttattgtgattatacaattttcaaacaagtatttagtgatgctttaacaacctttagt
tgggataaaacgtgtgctgctggtgattcttcagacgacacacctttatatcgatccgac
aaggaatggaagattttaatgtcaatctttgttccattgtcggcaattgtcggattactt
cttggtttattccttccagccattttccgtaaagtaacctctgatacaagggaataccaa
tctttaaatcataataatgctggattagttaaaatttggacctgtattgtttcccaatca
taa

DBGET integrated database retrieval system