KEGG   Cavenderia fasciculata (cellular slime mold): DFA_05004Help
Entry
DFA_05004         CDS       T02668                                 

Gene name
maoA
Definition
(RefSeq) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00260  Glycine, serine and threonine metabolism
dfa00330  Arginine and proline metabolism
dfa00340  Histidine metabolism
dfa00350  Tyrosine metabolism
dfa00360  Phenylalanine metabolism
dfa00380  Tryptophan metabolism
dfa01100  Metabolic pathways
dfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DFA_05004 (maoA)
   00330 Arginine and proline metabolism
    DFA_05004 (maoA)
   00340 Histidine metabolism
    DFA_05004 (maoA)
   00350 Tyrosine metabolism
    DFA_05004 (maoA)
   00360 Phenylalanine metabolism
    DFA_05004 (maoA)
   00380 Tryptophan metabolism
    DFA_05004 (maoA)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     DFA_05004 (maoA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox FAD_oxidored FAD_binding_2 Pyr_redox_2 Lycopene_cycl HI0933_like GIDA FAD_binding_3 GDI Thi4 Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 14875164
NCBI-ProteinID: XP_004360725
UniProt: F4PMY1
Position
Unknown
AA seq 461 aa AA seqDB search
MATQYDVIVIGGGLSGAQCAADLKSKGVNVLLIEARDRFGGRTESIKVEDYWFDLGGQWM
GGTHNILKKVCNELRIESFPQYDEGNHILELNNKHTLYKGNISTLNTDYNLEGLESTIAI
IDKMAEELDASKPYDHPRAKEWDNITLANWIRDNVKGSDAVKILNWFCKVCLAGEPTEIS
FLWYLLFIKAAGGYGVLADIRGGAQQDRLIGGSQQISERLVRERVGNFLLNCKVVGIHQD
NAGVTVLIEGGQRFRAKFVANTIPPALAGRIDYKPALPASRDSLTQRMPMGSVIKTIVIY
DEPFWRRDGFSAEALSEHGPIFICYDDSSHDDKANAIVGFIAGQDAREWSEKTPEVRKQA
VLECYARWFGPRALKPKYYLEKDWKTDEFARGAYLAFAQPGTLTACGKSLREPVGRMHFA
GTETATQWIGYMEGALESGLRCSKELQSRLQQDQQSYNSKL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccacacaatatgatgttattgttatcggaggaggtttatcaggagctcaatgtgct
gctgatttgaaatcaaagggtgttaatgtattattgattgaagctagagatagatttggt
ggacgtacagaatcgataaaggtagaagattattggtttgatttgggtggacaatggatg
ggaggtactcataacattctcaaaaaggtgtgtaatgaattacgtatcgaatcattccct
caatacgacgaaggaaaccatatactcgaattaaacaacaagcataccctctacaaggga
aacatctccaccttgaacactgactataacttggaaggtctcgaatccaccattgcaatc
attgacaagatggccgaagaattggatgcttccaaaccatatgatcatccaagagctaaa
gaatgggataatattacattggcaaattggatcagagataatgtaaagggatcggatgca
gttaagattttgaattggttctgtaaggtatgtttggcaggtgagccaacagagattagt
ttcttgtggtacttgcttttcatcaaggctgccggtgggtatggcgtgttggccgatatc
cgtggtggcgcccaacaagatcgtttgattggtggttcgcaacagatttcagagcgattg
gtgagagagcgtgtcggcaactttttgctcaactgcaaggtcgtcggcatccaccaagac
aatgccggtgtgaccgtgttgatcgagggtggccaacgtttccgcgccaagtttgttgcc
aacacgatcccacctgctttggccggtcgtatcgactacaaacccgctctcccagcttcg
cgtgattctctcacccaacgtatgccaatgggatcggttatcaagaccattgtcatctac
gacgaacctttctggcgtagagacgggttctcggccgaagcattgtccgagcacggtccc
atctttatctgctacgacgactcgtcgcacgacgacaaggcaaatgccatcgtcggcttt
atcgccggtcaagacgcacgcgagtggagtgaaaagacaccagaggtccgtaaacaagct
gtcctcgaatgctatgcccgttggtttggtccacgtgccctcaaaccaaagtactacctc
gaaaaggactggaagaccgacgagtttgccagaggtgcctatcttgcctttgcccaaccc
ggcaccctcaccgcctgcggcaagtcactccgcgaaccagtcggtagaatgcattttgcc
ggtactgaaacagctacccaatggatcggatacatggaaggtgctttggaaagtggtctc
cgttgttccaaagaattacaatcaagattacaacaagatcaacaatcttataattcaaaa
ctttaa

DBGET integrated database retrieval system