KEGG   Cavenderia fasciculata (cellular slime mold): DFA_06594Help
Entry
DFA_06594         CDS       T02668                                 

Gene name
mai
Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00350  Tyrosine metabolism
dfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DFA_06594 (mai)
Enzymes [BR:dfa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     DFA_06594 (mai)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C Glutaredoxin GST_C_2
Motif
Other DBs
NCBI-GeneID: 14875987
NCBI-ProteinID: XP_004362295
UniProt: F4PJF8
Position
Unknown
AA seq 180 aa AA seqDB search
MTETVLYSYWRSSCSWRVRIALAYKKVEYKYVAVHLVKSQQSDQEYEKLNAMKVVPTLII
DGNTLGQSLSILEYLEETRPQVPLLPTDAAKRAVVRQMMQIIGSDIQPLQNLKVLNKIAE
ISGGDQSKKQVWASTWIANGFNGLEKLLEKHSGKYCVGDQVTFADLCIPAQVYNANRFNN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacagttttatatagttattggagatcatcttgttcatggagagttagaatt
gcattggcctataaaaaggtagaatacaagtatgttgcagtgcatcttgtcaagagccaa
caaagtgatcaagagtatgaaaagttgaatgctatgaaggtcgtaccaaccttgatcatc
gatggcaacacattgggacaatcattgtccatacttgaatacttggaagagacaagacct
caagtacctcttttacctaccgatgctgccaaacgtgctgttgtacgtcagatgatgcaa
atcattggatctgacattcaaccacttcagaatctcaaagtactcaacaagattgcagag
attagtggtggtgatcaatcaaagaaacaagtatgggcaagtacttggatcgccaatgga
ttcaatggtcttgaaaaacttttagagaaacatagtggaaagtattgtgttggtgatcaa
gttacttttgctgatttatgtattcctgctcaagtttataatgccaatcgtttcaataat
taa

DBGET integrated database retrieval system