KEGG   Cavenderia fasciculata (cellular slime mold): DFA_09906Help
Entry
DFA_09906         CDS       T02668                                 

Gene name
scsA
Definition
(RefSeq) succinate-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00020  Citrate cycle (TCA cycle)
dfa00640  Propanoate metabolism
dfa01100  Metabolic pathways
dfa01110  Biosynthesis of secondary metabolites
dfa01130  Biosynthesis of antibiotics
dfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DFA_09906 (scsA)
   00640 Propanoate metabolism
    DFA_09906 (scsA)
Enzymes [BR:dfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     DFA_09906 (scsA)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DFA_09906 (scsA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 14867375
NCBI-ProteinID: XP_004351803
UniProt: F4Q8R4
Position
Unknown
AA seq 320 aa AA seqDB search
MKKRKMLARSSILRQAFVRGYASKPFVMVNKDTKVICQGFTGKQGTFHSQQAIDYGTQMV
GGVSPGKGGSKHLDLPVFNSVKEAKKATDANASVIYVPPPYAAQAIIEAIEAEMELVVCI
TEGIPQQDMVRVKYLLNRQNKTRLIGPNCPGIIKPGECKIGIMPGHIHRPGKIGIVSRSG
TLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGEAE
EEAALWLKENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVIMS
LSPAKLGVTMLEAMKKIGKA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaggaagatgttggctcgttcaagcattttaagacaggcttttgttagaggt
tacgcctcgaagccatttgtgatggtcaacaaggacaccaaggtgatctgccaaggtttc
acaggcaagcaaggaaccttccactcgcaacaagctatcgactatggcacccagatggtc
ggaggtgtctcccccggaaagggcggcagcaagcatctcgacctgcccgtctttaactcg
gtcaaggaggccaaaaaggcaaccgacgccaacgcctcggtcatctacgtgccaccccca
tatgccgcccaagccatcattgaggccatcgaggccgagatggaattggttgtttgcatt
actgaaggtattccacaacaagacatggtacgtgtaaagtacttgctcaaccgtcaaaac
aagacacgtctcatcggaccaaactgcccaggtatcatcaagcccggagagtgcaagatt
ggtatcatgccaggtcacatccatcgtccaggtaagattggtatcgtctcgcgttcaggt
accctcacctacgaggctgttgcccaaaccactgccgtcggtctcggtcaatccacctgt
gtcggtatcggtggtgatccattcaacggcaccaactttgtcgactgtctcaagctcttt
accaaggatccacaaactgaaggtatcatcctcatcggtgaaatcggtggtgaagccgaa
gaagaagctgccctatggctcaaggaaaatccaactgacaagccagttgtctctttcatc
gctggtttaactgctccaccaggtcgtagaatgggtcacgctggtgccattatcagtggt
ggtaagggaggtgctgatagcaagatgaaggctttacaagatgctggtgtcattatgtca
ctctcaccagccaagttgggtgtcaccatgctcgaagccatgaagaaaattggcaaagct
taa

DBGET integrated database retrieval system