KEGG   Deinococcus ficus: DFI_05735Help
Entry
DFI_05735         CDS       T05674                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dfc  Deinococcus ficus
Pathway
dfc00260  Glycine, serine and threonine metabolism
dfc01100  Metabolic pathways
dfc01110  Biosynthesis of secondary metabolites
dfc01120  Microbial metabolism in diverse environments
dfc01130  Biosynthesis of antibiotics
dfc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DFI_05735
Enzymes [BR:dfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DFI_05735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ASN80565
UniProt: A0A221SV89
Position
complement(1161173..1162207)
Genome map
AA seq 344 aa AA seqDB search
MTLPDTAARRKVIADFRSDTVTTPTPEMREAMARAEVGDDVYGEDPTVNALQAEVARLTG
HEAGLFMPSGSMTNQVAIAVHTRRGEEVVCAEGSHIYEWELGMMAAFSGVVPRFVPAPLG
VPDPAQVRAAVRRSVHQSPTGLISLENTHNKAGGTVIPLDVLAQIRAVADDEGLPLHLDG
ARVFNAAAALDVPLHEITRHFHTVSVCLSKGLGAPVGSVLTGSREAMKQAHRYRKMLGGG
MRQAGVLAAAALVALRDGPARLNDDHRRTRQLAGALVDAGYRVDLAAVQTNIIYVDLPDA
QQRVEEWDARGVRASALGPGSVRFVLHHQVSDEALEGAIGVLTA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccggacaccgctgcccgccgaaaagtgattgccgatttccgttccgatacc
gtgaccacccccacccccgagatgcgggaagcgatggcccgcgccgaggtcggcgacgac
gtgtacggcgaggacccgaccgtgaacgccctgcaggccgaggtggcccgcctgacgggt
cacgaggcggggctgttcatgccgtccggcagcatgaccaaccaggtcgccatcgccgtg
cacacccgccggggcgaggaggtcgtgtgcgccgagggctcgcacatctacgagtgggag
ctgggcatgatggcggccttcagcggcgtggtgccgcgcttcgtgccggcgccgctgggc
gtgccggacccggctcaggtgcgcgccgcggtgcgccgcagcgtgcaccagtccccgacg
ggcctgatcagcctggagaacacgcacaacaaggccggcggcaccgtgatcccgctggac
gtgctcgcgcagatccgcgcggtcgcggacgatgagggcctgccgctgcacctggacggg
gcgcgggtgttcaacgccgccgcggcgctggacgtgccgctgcacgagatcacccggcac
ttccacacggtcagcgtgtgcctcagcaagggcctgggcgccccggtgggcagcgtcctg
accggcagccgcgaggcgatgaagcaggcgcaccgctaccgcaagatgctgggcggcggg
atgcggcaggccggcgtgctggccgccgcggccctggtggccctgcgggacggcccggcc
cgcctgaacgacgaccaccgccgcacccggcagctggccggggcgctggtggacgccggg
taccgcgtggacctcgcggcggtgcagacgaacatcatctacgtggacctcccggacgcc
cagcagagggtggaggaatgggacgcgcgcggcgtgcgcgccagcgcgctggggccgggc
agcgtgcgtttcgtgctgcaccaccaggtgagcgacgaggcgctggaaggggccatcggc
gtcctgaccgcctga

DBGET integrated database retrieval system