KEGG   Deinococcus ficus: DFI_07070Help
Entry
DFI_07070         CDS       T05674                                 

Definition
(GenBank) homoaconitate hydratase
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
dfc  Deinococcus ficus
Pathway
dfc00300  Lysine biosynthesis
dfc00680  Methane metabolism
dfc01100  Metabolic pathways
dfc01120  Microbial metabolism in diverse environments
dfc01130  Biosynthesis of antibiotics
dfc01210  2-Oxocarboxylic acid metabolism
dfc01230  Biosynthesis of amino acids
Module
dfc_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    DFI_07070
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    DFI_07070
Enzymes [BR:dfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     DFI_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ASN80797
UniProt: A0A221SVW9
Position
complement(1442623..1443126)
Genome map
AA seq 167 aa AA seqDB search
MPRIWKFGDSVNTDDILPGKFAPFMAGEDVFQTFAFHYIRPEFAAAVQPGDVLIGGRNWG
LGSSREYAPQALKKLRIGGIVAPSFARIHYRNLLNLGIPAFAYDLTGVLEDGAEVSLDAA
SGELRHAGGVIQLPPPPEFLREALAAGSILEFFKQHGRFPGEKPAGE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaatctggaaattcggtgacagcgtgaacacggatgacatcctgcccggcaag
ttcgcgccgttcatggccggtgaggacgtgttccagaccttcgcgttccattacatccgc
ccggagttcgccgcggcggtgcagcccggggacgtgctgatcggcgggcggaactggggc
ctgggcagcagccgcgagtacgccccgcaggcgctgaagaaactgcggatcggggggatc
gtggcgcccagtttcgcgcgcatccactaccgcaacctgctgaacctgggcatcccggcc
ttcgcgtacgacctgaccggcgtgctggaggacggcgccgaggtgagcctggacgccgcc
agcggggaactgcgccacgcggggggcgtgatccagctgccgcccccgccggagttcctg
cgggaggccctggcggccgggagcatcctggagttcttcaagcagcacggccgctttccc
ggggagaaacccgccggggagtaa

DBGET integrated database retrieval system