KEGG   Deinococcus ficus: DFI_07875Help
Entry
DFI_07875         CDS       T05674                                 

Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
dfc  Deinococcus ficus
Pathway
dfc00250  Alanine, aspartate and glutamate metabolism
dfc00330  Arginine and proline metabolism
dfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DFI_07875
   00330 Arginine and proline metabolism
    DFI_07875
Enzymes [BR:dfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DFI_07875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ASN80926
UniProt: A0A221SWE3
Position
1603670..1605247
Genome map
AA seq 525 aa AA seqDB search
MTGTLMEGFLRFEHEPYHNFQDPATAQAQEKAFRSVREQYVGRTFPMIIAGREATGEKMH
DVHNPADTREVVWRFPNATHAQREEAIAAAKAAFEDWRFSDPFQRATIFKRAAELLRARR
FEFNAVMTLENGKNWSEADGEVAESVDHFEVFAREAMRWAQGKAVYPMPDEHVTTVYEPL
GVVACINPWNFPSAIPLGMALGAIAAGNTVIWKPASDTPLSSYLMVELLFQAGLPRGVIQ
FVTGDHDVLGDDLVDHKDIRMIAFTGSKNIGCRIYERASKVHPGQRWLKRVIAEMGGKDP
MVICADADLDEAAAGIVAAAFGYAGQKCSACSRVIAEDSVYDALLEKVVERAKRLKVGLP
EDNADLGPVIHERAARNILRYIEGGKKTAKLVLGGDQPDMGDRRGGYVNPTIFSEVEPND
PLFQEEIFGPVLAFSRARDWRHAIELANDSEYGLTASFYSRDPHKITEARKLMHFGNLYI
NRKCTGALSGTHAFGGYGMSGTNAKVGGPDYLFWFMQTKTIAQRY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacgctgatggagggtttcctccgctttgagcacgagccctaccacaacttc
caggaccccgccaccgcgcaggcgcaggaaaaggccttccgcagcgtgcgcgagcagtac
gtgggccgcaccttccccatgatcatcgccgggcgcgaggccacgggcgagaagatgcac
gacgtgcacaaccccgccgacacccgcgaggtcgtgtggcgcttcccgaacgccacgcac
gcccagcgtgaggaggccatcgccgccgcgaaggccgcgttcgaggactggcggttcagt
gaccccttccagcgcgccaccatcttcaagcgcgcggcggagctgctgcgggcgcgccgg
ttcgagttcaacgccgtgatgaccctggaaaacggcaagaactggtccgaggccgacggg
gaggtcgccgagagcgtggaccacttcgaggtgttcgcgcgcgaggcgatgcgctgggcg
cagggcaaggccgtgtaccccatgcccgacgagcacgtcaccaccgtgtacgagccgctg
ggcgtggtggcctgcatcaacccctggaacttccccagcgcgattccgctcgggatggcc
ctgggtgctatcgcggccgggaacaccgtgatctggaagccggccagcgacaccccgctc
tccagttacctgatggtggaactgctgttccaggcgggcctgccgcgcggcgtgatccag
ttcgtgaccggcgaccacgacgtgctcggcgacgacctcgtggaccacaaggacatccgc
atgatcgccttcaccggcagcaagaacatcggctgccgcatctacgagcgggccagcaag
gtccaccctgggcagcgctggctcaagcgcgtgatcgcggagatgggcggcaaggacccc
atggtgatctgcgcggacgccgacctggacgaggccgcggccgggattgtggccgccgcg
ttcgggtacgccgggcagaagtgcagtgcgtgcagccgcgtgatcgccgaggacagcgtg
tacgacgcgctgctggagaaggtcgtggagcgcgccaagcgcctcaaggtggggctcccc
gaggacaacgcggacctgggcccggtcattcacgagcgcgccgcgcggaacatcctgcgc
tacatcgagggcggcaagaagaccgcgaaactcgtgctgggcggtgaccagccggacatg
ggcgaccgccgcggcgggtacgtgaaccccaccatcttcagcgaggtggagcccaacgat
ccgctgtttcaggaggagatcttcgggccggtgctggccttctcccgcgcgcgcgactgg
cgccacgcgatcgaactggcgaacgacagcgagtacggcctgaccgccagcttctacagc
cgcgacccgcacaagatcaccgaggccaggaagctcatgcacttcgggaacctgtacatc
aaccgcaagtgcaccggggcgctgtccggcacgcacgcctttggcgggtacggcatgagc
ggcacgaacgccaaggtcggcggcccggactacctgttctggttcatgcagaccaagacc
atcgcccagcggtactga

DBGET integrated database retrieval system