KEGG   Deinococcus ficus: DFI_08450Help
Entry
DFI_08450         CDS       T05674                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
dfc  Deinococcus ficus
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DFI_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASN81024
UniProt: A0A221SWK6
Position
1726877..1727284
Genome map
AA seq 135 aa AA seqDB search
MSRVPPGLPDDPAAPDVRVSVQVQHLPQHSVPGRQLFTYVIVIENHADDTWQVMARQWSI
TDGAGRVTEVEGEGVVGEQPIIPAGGSFTYDSFVTVEATPGRMRGWYTLRNAWGQGARVP
IPEFLLDVPGQRVLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgttccgcccggccttccagacgaccccgccgcgccggacgtgcgggtgagc
gtgcaggtgcagcacctgccgcagcacagcgttccaggccggcagctgttcacgtacgtg
atcgtgatcgagaaccacgccgacgacacctggcaggtcatggcgcgccaatggtccatc
acggacggcgcgggccgcgtgacggaggtcgagggtgagggcgtggtgggtgagcagccc
atcattccggccgggggaagtttcacgtacgactcgttcgtgacggtggaggccacgccg
ggccgcatgcggggctggtacacgctgcgcaacgcctgggggcagggcgcgcgggtgccg
attccggagttcctgctggacgtgccgggccagcgggtcctgaactga

DBGET integrated database retrieval system