KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_0747Help
Entry
Desfe_0747        CDS       T02136                                 

Definition
(GenBank) cytidyltransferase-related domain protein
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00760  Nicotinate and nicotinamide metabolism
dfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Desfe_0747
Enzymes [BR:dfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Desfe_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like HIGH_NTase1
Motif
Other DBs
NCBI-ProteinID: AFL66644
UniProt: I3XRS0
Position
719759..720307
Genome map
AA seq 182 aa AA seqDB search
MNAGRCLIIARFQPFHYGHLNAVEYCYRNYDETIIVVGMASQSHTPENPFTAGERILMIR
ESLKWAGHDLSRYITVTLPTLEVNRAAIHFVRQYSPPFKSVITLNPIIQRLFMEEGYEVI
TPPLKERDTYSGSTIRRLILNNDPLWKQLVPPPVVEIIESIGGVERIKMLYSERLPGYYA
TA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgggagatgccttataatagcgaggtttcagccattccattacggccattta
aacgctgtagagtactgttatagaaactatgatgaaaccataatagtggttgggatggct
agtcaaagccatacacctgagaacccgtttacagctggtgagagaatacttatgattagg
gaatcacttaaatgggctggacatgatttatcaaggtatataacggttactcttcccaca
ctcgaggtgaatagggcggccatacactttgttagacaatacagtcctccatttaaatcc
gtgatcacattaaacccgataatacagaggctcttcatggaggaagggtatgaggtgatt
accccgcccctcaaggagagggatacatatagtggttcaaccattagacggctaatacta
aataatgaccccctgtggaaacaattagttccgccaccagtcgtggagataattgaaagt
ataggaggagtggagagaataaagatgctttacagtgagaggctaccagggtattatgcc
accgcctaa

DBGET integrated database retrieval system