KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1247Help
Entry
Desfe_1247        CDS       T02136                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00630  Glyoxylate and dicarboxylate metabolism
dfd01100  Metabolic pathways
dfd01110  Biosynthesis of secondary metabolites
dfd01120  Microbial metabolism in diverse environments
dfd01130  Biosynthesis of antibiotics
dfd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desfe_1247
Enzymes [BR:dfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Desfe_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697 LigA
Motif
Other DBs
NCBI-ProteinID: AFL67116
UniProt: I3XT42
Position
1183174..1184511
Genome map
AA seq 445 aa AA seqDB search
MSGKFEFETYHEYIDKNYTPDPSNDVIAVYRVKPAQGFTIEDAAGGVAAESSTGTWTSLY
NWYDVGRVRRLSGKAYYFKDLGDGSWIVKIAYPVELFEEGNIPGLLASIAGNIFGMKRVE
GLRLEDIYLPKKFLESFKGPSKGLNGVREIFGIKDRPIVGTVPKPKEGYSPEEVEKLALE
LLSGGLDYIKDDENLTSPSFCRFEARAKAIMKVIDKVEKETGERKVWFANITSDIREMER
RLRLVADYGNPYIMVDVVIAGWSALTYIRDLAEEYGLAIHGHRAMHAAFTRNPYHGISMY
VLAKLYRIIGIDQLHIGTAGAGKLEGGKLDVVRYAKILRETHFKPDPDDIYHLEQPMHHI
KPAMPVSSGGLHPGNLPPVIEALGTNLVLQIGGGVIGHPDGPRAGALAVRQALEAIMNNI
PLDEYAKTHRELARALEKWGFVKPI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaaattcgagtttgaaacataccacgagtacatagacaagaattatactcct
gaccccagcaacgatgtaatagctgtatacagggttaagcctgcacagggattcactatt
gaggatgctgcgggaggtgtagccgctgagagtagtactggtacgtggaccagtctttac
aactggtacgatgtagggagagttagaaggctgagtggtaaagcatactacttcaaagat
cttggcgatggatcatggattgtgaaaatagcatacccagtggagttattcgaggaagga
aatataccgggcctgctggcatccatagctggaaacatattcggtatgaagcgtgttgaa
ggattacgactcgaggacatatatctccccaagaaattcctcgagtcatttaagggaccc
agtaagggattaaatggtgttagagagatattcgggataaaggataggcctatagtaggc
acggtgccgaagcccaaggagggttactcaccggaggaagtggagaagctggctttagag
ttgctaagcggtggattagactacataaaagacgatgaaaacctgaccagcccaagcttc
tgtaggttcgaggccagagctaaggccattatgaaggtcattgataaagtagagaaagag
acaggtgagagaaaagtctggttcgccaatattacctccgatatacgtgaaatggagagg
aggctgaggcttgtagcagactacggtaacccatacataatggttgatgtcgtgatcgcc
gggtggagcgcgctgacatatatcagggatctagcagaggagtatggactagcaatacat
gggcacagagcgatgcatgcagccttcactaggaatccataccacggcatctcaatgtac
gtgctggctaaattatacaggatcataggaatagaccaactacacatcggcacagccggg
gcaggaaaactcgagggcgggaagctagacgttgtaagatacgctaaaatactgagagag
acacacttcaagccagacccagatgacatataccacctagagcaaccaatgcaccacatc
aagccggcaatgcctgtctcatcaggtggtttacacccaggtaacctcccaccagtaata
gaggctctaggtacaaacctggtgctacaaataggtggtggggtaataggtcatccagac
ggacccagagccggagcactagctgttagacaggcactagaggcaataatgaataatatt
ccactagacgagtacgctaaaacacatagagagctggcaagagcactggagaaatggggc
ttcgtaaaacccatctag

DBGET integrated database retrieval system