KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1298Help
Entry
Desfe_1298        CDS       T02136                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00010  Glycolysis / Gluconeogenesis
dfd00020  Citrate cycle (TCA cycle)
dfd00620  Pyruvate metabolism
dfd00640  Propanoate metabolism
dfd00650  Butanoate metabolism
dfd00680  Methane metabolism
dfd00720  Carbon fixation pathways in prokaryotes
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01130  Biosynthesis of antibiotics
dfd01200  Carbon metabolism
Module
dfd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desfe_1298
   00020 Citrate cycle (TCA cycle)
    Desfe_1298
   00620 Pyruvate metabolism
    Desfe_1298
   00640 Propanoate metabolism
    Desfe_1298
   00650 Butanoate metabolism
    Desfe_1298
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desfe_1298
   00680 Methane metabolism
    Desfe_1298
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desfe_1298
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desfe_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N PCIF1_WW
Motif
Other DBs
NCBI-ProteinID: AFL67166
UniProt: I3XT92
Position
1224461..1225642
Genome map
AA seq 393 aa AA seqDB search
MGMKKALTGNYAVSYAVKLARPDVIAAYPITPQTSIVEKLSEMIENGELDSVMIRVESEH
SALAACFGAAVAGARVFTATSSQGLLYMHEVVHWASRARIPMVMAIVSRTINTPWNIWPD
HSDFMDQRDAGWVMSYAMDNQEALDLVLQAFKISEDPSVYLPVMVGLEGFILGHTTMPVD
IPDESMVREWLGPRRQGYIIDGGTPLAVGGLTMPEDTENIFYGIQEAMNEAKKVIKEVTN
EYNKLFGRKYSGLIECFHCSDAKYITISMGAWSGDLMEAVEKLHSEGYPIGLIRIRYYRP
FPIEDIWEVIRSSKGVLVYDRSISFGSYGPIFTDLAGGLLTYTRNPPYVSNIVAGIAGVN
VTAEDFYKLTKEFIDEVEKNGQPPGFKWVMIRR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggcatgaagaaggctttaacaggtaactacgccgtatcatacgcggtgaaactggca
agaccggacgtaatagccgcctatccgataacacctcagacaagcatagttgagaaactc
tcggaaatgatagagaacggtgaattggattcggtgatgatcagggttgaatcagagcat
tcagcactagctgcatgcttcggggcagccgtagccggcgccagagtattcaccgcaaca
agcagccaagggctcctctacatgcatgaagtagtacactgggcctccagggccaggata
cccatggtcatggctatagtatccaggacaattaataccccatggaatatatggcccgac
cacagcgacttcatggatcaacgcgacgccggctgggtaatgagttacgcaatggataac
caggaggcattagacctagtgctacaggccttcaagatcagtgaggacccctcggtatac
ctcccagtcatggttggacttgagggcttcatactaggacacactacgatgcctgtcgac
atacctgatgaatcaatggttagagaatggcttggtccccgtagacaggggtacatcatc
gatggaggcaccccacttgcagtaggcgggctaacaatgcctgaggacacagagaatatt
ttctatggaatacaggaggcaatgaatgaggcgaagaaagtgatcaaggaggttactaat
gagtacaataagctatttggaagaaaatatagtggactcatagaatgtttccactgtagt
gatgcaaaatacattactatatcaatgggtgcctggagtggtgatctcatggaggcagtg
gaaaagctacatagtgaaggataccccattggattaatacgtataagatactaccgtcca
ttcccaatagaagacatatgggaggtaattagaagcagtaaaggagtactggtatacgat
agatcaataagcttcggctcatatggcccaatattcacggatctagcaggtggattacta
acctacacaaggaaccccccctatgtatccaacattgtggcagggatcgccggcgtcaac
gttacagccgaggacttctacaagcttacaaaggagttcatagacgaggttgaaaagaat
ggccaaccacccggctttaaatgggtaatgatcaggaggtga

DBGET integrated database retrieval system