KEGG   Dyadobacter fermentans: Dfer_0139Help
Entry
Dfer_0139         CDS       T00970                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00625  Chloroalkane and chloroalkene degradation
dfe00680  Methane metabolism
dfe01100  Metabolic pathways
dfe01120  Microbial metabolism in diverse environments
dfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Dfer_0139
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dfer_0139
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Dfer_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP AdoHcyase_NAD FAD_binding_2 adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACT91410
UniProt: C6VVV4
Position
152687..153874
Genome map
AA seq 395 aa AA seqDB search
MCQNHGVAYIKPGEVEIQEIEYPKLALGDRKCEHGVILKIVSTNICGSDQHMVRGRTTAP
AGLVLGHEITGLVIEAGRDVEFIKVGDLVSVPFNIACGRCRNCKEGKTGICLNVNPSRPG
AAYGYVDMGGWVGGQAEYVMVPYADFNLLKFPDKDQAMAKIKDLTLLSDIFPTGFHGAVT
AGVGPGSIVYVAGAGPVGLACAASCHLLGAAVVIVGDMIPERLAQAASFGCEVIDLTKDT
PLEQAIAEIVGVPEVDCFVDCVGFEARGHGAHAVEERPATVLNTAMAVTRAGGAIGIPGL
YVTGDPGARDTAAKEGSLSIRIGLGWAKSHSFYTGQCPVMKYHRNLMNAILWDKIQIAKA
VNVEVISLQDAPRGYADFDKGAAKKFVIDPHGMIV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaaaatcatggagtagcttacattaaaccgggagaagtggagattcaggaaatt
gaatatcctaaactggcgcttggcgaccgcaaatgcgagcacggcgtgatcctgaaaatc
gtttctaccaacatttgcggtagcgaccagcacatggttcgcggacgtacaacagcaccg
gcagggcttgtgctcggtcatgaaatcaccggtctggtgatcgaagcgggccgcgatgtt
gagttcattaaagtgggcgatctcgtttccgtaccgttcaacattgcctgcgggcggtgc
cgtaattgcaaagagggtaaaaccggtatttgcctcaatgtgaacccttcgcgccccggc
gctgcgtatgggtatgtggatatgggcggctgggtaggcggccaggccgagtacgtgatg
gtgccctacgccgatttcaacctgctgaaattccccgacaaggaccaggcgatggccaaa
atcaaggaccttacgctgctttccgatattttcccgaccggtttccacggtgctgttacg
gccggggtaggcccgggctccattgtgtatgtggccggcgcggggcctgtgggccttgcc
tgtgcggcttcctgccatttgcttggcgctgccgttgtgatcgtcggggatatgattccc
gagcgccttgcccaggcggcgagcttcggctgcgaggtgatcgatctcacgaaggatacg
ccgctggaacaggccatagccgaaatcgtgggtgttcccgaagtagattgtttcgtcgac
tgcgtgggtttcgaagcccgtggtcatggtgcgcatgccgtcgaagagcgccccgctacc
gttttgaacacggctatggccgttacccgggccggcggcgctattggtattccgggcctc
tacgttaccggcgacccgggtgcccgcgatactgcggccaaggaaggcagcctcagcata
cggatcggcctcggatgggccaaatcgcattcattctacaccggccaatgcccggtgatg
aagtaccatcggaatttaatgaatgcgattttgtgggataagattcaaatcgcaaaggct
gtcaatgtggaagtaatctcactgcaagacgcgccgagaggttatgcggatttcgacaaa
ggagccgcgaagaagtttgtgatcgatccgcatgggatgattgtttaa

DBGET integrated database retrieval system