KEGG   Dyadobacter fermentans: Dfer_1148Help
Entry
Dfer_1148         CDS       T00970                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00860  Porphyrin and chlorophyll metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
Module
dfe_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dfer_1148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dfe01007]
    Dfer_1148
Enzymes [BR:dfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Dfer_1148
Amino acid related enzymes [BR:dfe01007]
 Aminotransferase (transaminase)
  Class III
   Dfer_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACT92397
UniProt: C6W537
Position
complement(1365742..1367034)
Genome map
AA seq 430 aa AA seqDB search
MNTSTSQQLFEKAQNYIPGGVNSPVRAFRAVGGNPIFIKSAKGPYIYDEDGNEYIELINS
WGPMILGHAHELIQKAVSDAIQHSFSFGAPTRREVEIAELIVSMVPSIEKVRMVNSGTEA
TMSAIRVARGYTGRDKIIKFEGCYHGHGDSFLIAAGSGAVTFGTPDSPGVTKGVANDTLT
APYNDLEAVQQLVDANKGQIAALILEPVVGNMGCVLPKEGFLEGLRRICDEEGIVLILDE
VMTGFRLSKGGAQERFGITPDLTTLGKIIGGGMPVGAYGGKAEIMNYVSPAGPVYQAGTL
SGNPIAMAAGYTMLTYLNEHPEVYTQLENAGNKLANGFRASMEKLGLNYTLNQIGSMYTL
FFTPDAVTDFPSAKSSDLPLFGKYFHAMLNRGIYMGPSQFEAMFLSIALTDAHLERIIAA
NEEALIEITA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcaacgagccagcaacttttcgaaaaagcacaaaattatatcccaggcggc
gtgaactcgcccgtacgcgcgttccgtgcggtaggcggtaacccgatatttatcaaatca
gctaaaggcccttacatctacgacgaggatggcaacgaatacattgaactgatcaactcc
tgggggccgatgatcctcggccatgcgcacgagctgatccaaaaggccgtttccgatgcc
attcagcattcattctcgttcggtgcgcctacgcgcagggaagtggagatcgcggagctg
atcgtgtcgatggtgccttcgattgaaaaggtgcggatggtgaattccggcacggaggct
acgatgtcggccattcgcgtggcgcgcgggtacaccgggcgcgacaagatcatcaagttt
gaaggttgctaccatgggcacggcgacagcttcctcattgcggctgggagcggagcggtc
acattcggtacgccggacagtccgggtgtaaccaaaggcgttgctaacgacaccctcacg
gccccttacaacgacctcgaagccgtgcagcaactcgtggacgcgaacaaaggccagatc
gccgcattgatcctcgaaccggtggtgggcaacatgggctgcgtgctcccgaaagagggt
ttcctggaaggattacgccgcatttgcgacgaagaaggcattgtcctgatcctcgacgaa
gtcatgaccggcttccggctttcgaagggcggagcgcaggaaagattcgggattacgccc
gatttaacgacgttaggaaaaattataggcggagggatgcctgttggcgcttacggaggc
aaagcggaaatcatgaactacgtttccccggccggtccggtttatcaggcgggaacgctt
tccggtaaccctatcgccatggcggcaggttacaccatgcttacctacctgaacgaacat
cccgaagtttatacccagctcgaaaatgcaggtaacaagctggcaaacggcttccgcgct
tcgatggaaaagttgggtttgaattacacattgaaccaaatcggttccatgtatacgctg
ttttttacaccggacgccgttaccgatttcccatcggccaagtcgtcggatctgccgttg
ttcggcaaatatttccacgcaatgctgaaccgcggcatttacatgggccccagccaattc
gaagccatgttcctctcgatcgcgctgacggacgcgcatttggagcggattatcgcggca
aatgaagaagcattgatagaaataacagcctaa

DBGET integrated database retrieval system