KEGG   Dyadobacter fermentans: Dfer_3585
Entry
Dfer_3585         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB
Other DBs
NCBI-ProteinID: ACT94792
UniProt: C6VU24
Position
4379176..4379625
AA seq 149 aa
MFNYGIGGNERKIDQSSEGIADIPQNRTLFATQLTGDPSPRPEMVYDLKTTEEVFAHYQP
EAEVEFITSDGSFINENLRFRNLGDFGKKGIIAQSAFLQDLDARNEAYQQVVRHLKVNKI
LKAALEKPEAKAALLGVFQTLINELEEAG
NT seq 450 nt   +upstreamnt  +downstreamnt
atgttcaactacggaataggcggtaacgaacgcaagattgaccagtccagtgaagggatt
gctgatattccccaaaaccgcaccctgttcgccacgcagctcaccggcgacccgtcgccg
cggcccgaaatggtttacgatctcaaaaccaccgaagaagttttcgcgcattaccagccc
gaggccgaggtcgaattcatcacttccgacggcagctttattaatgaaaacctgcggttc
agaaacctgggtgattttggcaaaaaagggatcatcgcgcaaagcgcattcctccaagac
ctcgacgcccgcaacgaagcctaccaacaggtagtgaggcatctcaaagtgaacaaaatc
ctcaaagccgcattagaaaaacccgaagctaaagccgccctcctgggcgtgttccagacg
cttattaacgagttggaggaggcggggtga

DBGET integrated database retrieval system