KEGG   Dyadobacter fermentans: Dfer_3586
Entry
Dfer_3586         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB
Motif
Pfam: TssC
Other DBs
NCBI-ProteinID: ACT94793
UniProt: C6VU25
Position
4379843..4381210
AA seq 455 aa
MADNTKTSQEATPALRERVAVPLETGLPQLAKYGSFDLVETIIEGAANINPEKKARKKIF
LTEADKKKERQQLKKRLELWSELLSSAESVPDMIEAGQKQADSAFELLKENLGKAVEQVR
PLEQSYRSVAMFFKNTEQDKVKNVTFLNAAPDQLQDLDVTTFIDAVGEELASKYDRLDLR
ENYSILNVPGYLGSGKVVDKWAKMAHKNKVMLLTDFMHLDAPEDVMELFESANLTGGSAH
LSNVMMTCNWLVGRAKHDDLGEEDDLYIPPSTALAGNVYKTLMSQVAAGKKHGTLSEVDG
VRFPLKKSEIADLEKMGLIPMVNEYSKVMAFSAKTLFNGDNVGLQTYSVVRVFDYITKVL
IDFLNRRAFENFDYNTKNDLKKQIIKFLDSVTGPGKLIEKFSVMRFEQDKNQKDKVYLDI
HMVPYFPAKNFMIALTGQKGDDLDAAAWAAEYAQQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcagacaatacaaaaacatcccaggaagccaccccggcgcttcgcgaacgcgtagcg
gttccgttggaaaccggcttgccgcagctggccaaatatggcagtttcgacctcgtagag
acgattatcgagggtgcggcgaacattaatcccgaaaaaaaggcacgcaagaagatattc
ctcaccgaggccgacaaaaagaaagagcgccagcaactgaaaaagcggctggaattatgg
tcggaactgctgagcagcgccgaaagtgtgccggatatgatcgaagccggccagaaacag
gcggattcggcatttgaactgctgaaagaaaacttgggcaaggccgtagagcaggtccgt
ccgctggaacaatcgtaccgctcggtggcgatgtttttcaaaaatacagagcaggataag
gttaaaaacgtcactttcctgaatgccgcgccggaccagttgcaggacctggatgtgacc
acgttcatcgacgccgtgggcgaagagctggcttcgaaatacgaccgcctcgatttgcgg
gaaaattattcgatcctgaatgtacccggctatctcggttcgggaaaagtagtggataaa
tgggcgaaaatggcccataaaaacaaggtaatgctgcttaccgacttcatgcatttggat
gcgccggaggacgtgatggaactcttcgaatccgctaacctgaccggcggctcggcgcat
ttatcgaatgtgatgatgacctgcaactggctcgtaggccgtgcgaaacacgacgacctg
ggcgaagaggacgatctctacattcccccatcgactgccctggccggcaatgtttacaaa
accctgatgtcgcaggtggcggcgggtaagaaacacggcacgctgagcgaagtggatggc
gtacgcttcccgctcaaaaaatcggaaatcgccgatctggaaaaaatggggctgatcccg
atggtgaatgaatacagcaaggttatggctttctctgccaaaacgctgttcaatggcgat
aatgtcggcttgcaaacctactcagtagtccgcgttttcgattacatcacgaaggtgctt
atcgatttcctgaaccgacgcgcgttcgaaaacttcgactacaacaccaaaaacgacctg
aaaaaacagatcatcaagtttctcgacagcgtaaccggcccgggcaaactgatcgaaaaa
ttcagtgtgatgcgttttgagcaggacaaaaaccagaaagacaaagtgtatctcgacatc
cacatggtaccctatttcccagccaaaaacttcatgatcgccctcaccggccagaaagga
gacgatctggacgcggcagcctgggcggcggagtatgcgcagcagtag

DBGET integrated database retrieval system