KEGG   Dyadobacter fermentans: Dfer_3735Help
Entry
Dfer_3735         CDS       T00970                                 

Definition
(GenBank) Glycogen (starch) synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00500  Starch and sucrose metabolism
dfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dfer_3735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dfe01003]
    Dfer_3735
Enzymes [BR:dfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dfer_3735
Glycosyltransferases [BR:dfe01003]
 Polysaccharide
  Storage polysaccharide
   Dfer_3735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 PapA_C
Motif
Other DBs
NCBI-ProteinID: ACT94940
UniProt: C6VWA9
Position
4546568..4548382
Genome map
AA seq 604 aa AA seqDB search
MEPFVKTTKKNVLFEVAWEVCNQVGGIYTVIRTKVPAMVEKWEENYFLLGPYFEKKASSE
FEQIHDLDDSPAGRIVKRMREMGFAVYYGYWLVTGKPRVVLFDIDSIMSQLDVIKFNLWE
RNRIPTINVEHLVNQTLCFGELVRIFLKEYADENAKREEIFAQFHEWMASSGLPELKREN
VKVATTFTTHATMLGRYLAQNVSGFYNKLPFFDWEQEAKNYGIVAQCSIERQAALSAHVL
TTVSDVTARECEVFLGRMPDLVTPNGLNVVRFQAVHEFQNLHLKHKERIHEFVMGHFFPS
YSFDLDKTLYFFTSGRYEYSNKGYDLTLEALARLNWKMVQANMDMTVVMFIVTKQPYTSV
NPDVLQSRAVLNELQETCTAIEKEVGEKLFLATASGTDHKMPDLNEFVDEYWRLRLRRTI
QSWKTDKLPAFVTHDLKQEDGITDFCKRANLVNNERDRVKIVYHPDFIASTNPLFGLDYG
QFVRGCHLGVFPSYYEPWGYTPLECVVRGVPTVTSDLSGFGDYIMQIMRDYENRGIYVIN
RKSQNFSQAADQLADILFKFVRMQRRDRIMQRNRVENISDVFDWMNLRSYYDTAHDLAAK
RRKP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttggaaccatttgtcaaaaccactaagaaaaacgtcctgttcgaagttgcatgggaggtt
tgtaatcaagttggagggatatatactgtcataaggaccaaagtgcctgccatggtggaa
aagtgggaggaaaactactttttgctgggcccttatttcgaaaagaaagcgtcttccgaa
tttgagcagattcacgacctggacgattctccggccggtcggatcgtcaagcgaatgcgc
gaaatgggctttgcggtgtactacggctactggctcgtgaccggcaaaccgcgcgtcgtg
ctgttcgatatcgacagcattatgagccagctcgatgtgatcaaattcaacctttgggaa
agaaaccgcattccgacaatcaacgtcgaacatcttgtcaatcagacgctttgtttcgga
gaacttgtacgtatattcctgaaagaatatgcggatgagaatgcgaaacgggaagagatt
tttgcgcagttccacgaatggatggccagcagcggcttgcccgagctgaaacgtgaaaat
gtgaaagttgccacgacgtttaccacgcacgctaccatgctgggccgctacctggcgcag
aatgtctcaggtttttataacaaactgccgttcttcgactgggaacaggaggccaaaaac
tatggcatcgtggcccaatgctcgatcgagcgccaggccgcgctgagcgcacatgtactc
accacggtgagcgacgtgactgcccgcgaatgcgaggtgttcctcggccgcatgcccgac
ctcgtcacgcccaatggcctcaacgtggtgcgtttccaggcggtccacgagttccagaac
ctgcatttgaagcacaaagagcgcattcacgagttcgtaatggggcatttctttcccagc
tactctttcgacctcgacaaaacgctgtactttttcacctctggccgctatgagtattcc
aataaaggttacgacctcacgctggaagccctggcgcgcctgaactggaaaatggtacag
gccaatatggacatgacggtagtgatgttcatcgtcaccaagcagccatacacgtcggtg
aaccctgatgtgctgcaatcccgcgcggtgctaaatgagttgcaggaaacgtgtacggcc
attgaaaaggaagtgggcgaaaagctcttcctcgcgacggcatccggcaccgaccataaa
atgcccgatctaaacgaatttgtcgacgaatattggcgcctgcgcctccgccggacgatc
caaagctggaaaaccgacaagttgccggcattcgtgacccacgatttgaagcaggaggac
ggcattaccgatttctgcaagcgcgccaacctcgtcaacaacgagcgcgaccgcgtgaag
atcgtttatcacccggatttcatcgcatctacgaacccattgttcggtctggattacggt
caatttgtacgcggctgccatctgggcgttttcccgagctactacgaaccctggggttac
acgccgttggaatgcgtcgtccgcggcgtgccaacggtcaccagcgacctctccggcttc
ggcgattacatcatgcaaatcatgcgtgactacgaaaaccggggcatttacgtgatcaac
cgcaaatcccagaatttctcgcaagccgctgaccagctcgccgacatcctcttcaaattc
gtccgcatgcaacgccgcgaccgcatcatgcagcgcaaccgcgtcgagaatatctcggat
gttttcgactggatgaatttgcggtcttactacgatacggcgcacgatttggctgcgaag
cggaggaaaccttga

DBGET integrated database retrieval system