KEGG   Dyadobacter fermentans: Dfer_3923Help
Entry
Dfer_3923         CDS       T00970                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08223  MFS transporter, FSR family, fosmidomycin resistance protein
Organism
dfe  Dyadobacter fermentans
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dfe02000]
    Dfer_3923
Transporters [BR:dfe02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Fosmidomycin resistance (Fsr) family [TC:2.A.1.35]
    Dfer_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP
Motif
Other DBs
NCBI-ProteinID: ACT95127
UniProt: C6VXU4
Position
4770301..4771557
Genome map
AA seq 418 aa AA seqDB search
MKSFEQSSPAGSPAAESVAAVSTAAATTSQTVFPILLALSFSHLLNDTMQSLIPSIYPMV
KDSFNLSFTQIGLITFTFQVSASVFQPLVGSFTDKRPQPYALAVGMCFTLLGLISLSMAN
SFQIVLLSVGLIGIGSAVFHPEASRVARMASGGKHGMAQSLFQVGGNAGSSLGPLLAALI
LLPYGRFQVIWFSLVALLAIIILSWVGGWYKQNLTTVVKKAATSVTQESHLPKSKVVISI
TILLLLIFSKYIYMASLSSYFTFYLIDKFGVSIQSSQIYLFAFLFAVAAGTFVGGPVGDK
IGRKYVIWISILGAAPFALLLPYVNLFWTGVLSCIIGLILSSAFSAILVYAQELIPGKVG
MIAGLFFGFAFGIAGIGSAILGTLADKTSIEYVFWICSFLPLIGLLTGFLPNLEKKHQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctttgagcagagttcccccgccggttcgccggccgccgaatccgtagcggca
gtttccactgcggcagccactacttcccagaccgtttttccgatccttctggcgctaagt
ttctcccatttgctgaacgacacgatgcaatcgctcatcccgtcgatttacccgatggtg
aaggactcgttcaacctcagctttacccaaatcggcctcattacgttcacattccaggtg
agtgcgtcggtatttcagccgctggtgggctcattcacagataaaaggccgcagccctat
gcattggcggtaggcatgtgttttacattgctcgggctgatttcgctttcaatggctaac
agtttccagattgtactgctttcggtagggcttatcgggatcggttcggcggtatttcac
ccggaagcttcgcgtgtggcgcgtatggcctcgggcgggaagcacgggatggcgcagtcg
ctgtttcaggtgggcggtaatgcgggcagttcgctcggtccgttgctggcggcgttgatt
ttgctgccttatggccgtttccaggtgatctggttctcgctggtggcattgctggcgatc
atcatcctgtcgtgggtaggcggctggtataagcaaaacctgacgacggttgtgaagaaa
gcagccacttcggtgacgcaggaaagccatcttcccaaatcaaaagtggtgatttcgatt
acgatcctccttttgctgatcttctcgaaatacatttatatggccagcctttcgagctat
ttcaccttttatctgatcgataaattcggcgtttccattcaaagctcgcagatttacctg
tttgcattcctttttgcggtggcggcggggacgtttgtcggcggaccggtgggtgataaa
atcggccggaaatatgtgatctggatctcaatcctcggtgcggcgccgtttgcattgctg
ctgccttatgtcaacttgttctggacgggcgttttgagctgcatcatcggtctgatcctc
tcctcggcattctcggcgatcctcgtgtacgcacaggaactgatcccgggcaaagtagga
atgatcgcagggctattcttcggcttcgcattcggcatcgccggcatcggttccgccatt
ctgggcaccctggcagacaaaaccagcatcgaatatgtattctggatctgctccttcctc
ccgctgatcgggttgctgacagggtttttgccgaatttggagaagaaacatcaatag

DBGET integrated database retrieval system