KEGG   Dyadobacter fermentans: Dfer_3928Help
Entry
Dfer_3928         CDS       T00970                                 

Definition
(GenBank) integrase family protein
  KO
K03733  integrase/recombinase XerC
Organism
dfe  Dyadobacter fermentans
Brite
Chromosome and associated proteins [BR:dfe03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Dfer_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 Phage_int_SAM_5 Integrase_1
Motif
Other DBs
NCBI-ProteinID: ACT95132
UniProt: C6VXU9
Position
4776316..4777188
Genome map
AA seq 290 aa AA seqDB search
MITPFLEFLQFEKRASAHTIKSYQTDLEQFQKYLLFQYECNEPETAKAPMLRSWVVSMME
EGLNPSSINRKIAALRTFYGYLRKKKHIDSDPTKILSALKTRKKLPAFVEEKSMELLFEE
GVFSEDFSGLRDRVIMELLYGSGIRLSELVELELKDLNLPARTIRVFGKRAKERIVPVST
SLAQLLHKYTEQRAPEEDTDVLLLTDSNKAIYPVFVQRKVKQYLSAVTTLSQKSPHVLRH
TYATHLLNRGADLNAIKELLGHANLAATQIYTHNSIEKLKKTHQQAHPKA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgataacgccgtttctggaattcctccaattcgaaaagcgcgccagtgcgcacacgatt
aaatcgtaccagactgatctcgaacagtttcagaaatacctcctttttcaatacgaatgc
aatgaacccgaaacggctaaggcgcccatgctgcgctcctgggtagtgagtatgatggag
gaagggcttaatccgtcgtccattaaccgcaaaatcgcggcactccgtacgttttatggc
tatttgaggaaaaaaaagcacatcgattccgatccgaccaaaatactttctgcattaaaa
acccgtaaaaaactgcctgcattcgtggaagagaagtccatggaactgctgtttgaagaa
ggcgtattttcagaagatttcagcgggctgcgcgaccgggtgatcatggaactgctctat
ggcagcggcatccggctgtcggaactggtggagctggaattgaaggatttgaatttgccg
gcgcggacgatccgggttttcgggaagcgggcaaaggaacggattgtgcccgtttccact
tccctggcgcaattgcttcacaaatatacggagcagcgcgcgccggaggaagataccgat
gtgctgcttttaaccgactcaaacaaagccatttacccggtttttgtgcagcggaaagta
aagcaatacctttccgccgtcaccaccctttcccagaaaagcccgcacgtgctccggcac
acctacgccacgcatttgctcaaccgcggcgccgatctgaatgcgatcaaggagttattg
ggccatgccaacctggccgctacgcaaatttacacccacaactccatcgaaaagcttaaa
aaaacgcatcaacaagcgcaccccaaagcctga

DBGET integrated database retrieval system