KEGG   Dyadobacter fermentans: Dfer_3932Help
Entry
Dfer_3932         CDS       T00970                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: ACT95136
UniProt: C6VXV3
Position
complement(4781939..4782847)
Genome map
AA seq 302 aa AA seqDB search
MEGPLISIITATYNRSNILAYSIHSVLNQTFRNWELIVIGDCCTDDTAEVVAGFRDPRIT
FINLEKNFGEQSGPNNEGLRRARGEYIAFLNHDDLWFPDHLEFSLRRLQSTGADLVLAAG
FIDHGEEQYRFYLSGVTSEKYGYHPSRIFVPASNWLFKNELVKDVGLWRPARELYVVPSH
DWLKRAYEAGKRIEPTRHFTVIAMPSSSRKNAYKDRMFSDSQHCFEQLRDNPHFREQLAI
KYLYRSFEENYYDEKTYYWRFFTKKIKTAFIALGFNTIEFNMRRAYKKGGLIASYRKKRG
LT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaaggccccctcatatcaatcatcaccgctacttacaaccggagcaatatccttgca
tacagcattcattcagttctgaaccaaactttcaggaactgggagctgattgtgatcggc
gattgctgtaccgacgatacggccgaagtggtcgcgggatttcgcgatccgaggatcaca
tttatcaacctggaaaaaaatttcggggaacaatccggccctaacaacgagggcctgcgc
cgcgcccggggcgagtacatcgcttttctcaatcacgacgacctctggtttcccgatcac
ctggaattttcgcttcgccgcctgcaatctaccggcgccgacctggtgctggcggccgga
ttcattgatcacggtgaagaacaataccggttttacctcagcggggtaacttccgaaaag
tatggctaccacccctcacgcatatttgtgcctgcaagcaactggttattcaaaaacgag
ctggtgaaggatgtaggcctgtggcgcccggcccgggagctttacgtggtgccttcacac
gactggctgaaacgcgcatacgaagccggaaagcgcattgaacctaccaggcatttcacc
gtgatcgccatgccgtccagctcgcggaagaatgcttacaaagaccgcatgttttcggac
agccagcattgttttgagcagctgcgtgacaatccccatttcagggaacagctggccatc
aagtatttatacaggtcttttgaagaaaattattacgacgaaaaaacctactactggcgg
ttttttaccaaaaaaatcaaaactgctttcatcgccctcggcttcaacacgatcgaattc
aatatgaggcgggcgtacaaaaaaggcggattgatagccagttaccgcaaaaaacgagga
ctcacttaa

DBGET integrated database retrieval system