KEGG   Dyadobacter fermentans: Dfer_3933Help
Entry
Dfer_3933         CDS       T00970                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_24 B-block_TFIIIC HTH_Crp_2 HTH_27 HTH_29 HTH_3 HTH_IclR HTH_36 Fe_dep_repress FeoC Rrf2 Fimbrial_PilY2 TrmB GntR
Motif
Other DBs
NCBI-ProteinID: ACT95137
UniProt: C6VXV4
Position
4783004..4783438
Genome map
AA seq 144 aa AA seqDB search
MTHQSDHRAYFFKIDTTIKKIRNALQKQLTEAGFDLTVDQWVLIDHIFRKQGISQNELAE
MTFKDPPTVTRIIDLLEKKGLVERGPAAGDRRKFNLFLTKNGEAIYNQAFPIVADIRRKG
WGSLSDSDYQHFVRIMDSIYQNFT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcagtcggatcatcgtgcctatttttttaagatagacacgactatcaaaaag
attcggaatgccctccaaaaacagcttaccgaagcggggttcgacctcacggtcgaccaa
tgggtattgatcgatcatattttcagaaaacagggcatcagccagaacgaactggcggaa
atgacattcaaagatcctcccacggtcacaagaatcatcgatttgctcgaaaagaaggga
ttggtagaacgcggccccgccgccggtgaccgccggaagttcaacctttttcttaccaaa
aacggcgaggccatctacaaccaggcatttccgatcgtggccgacatccgccggaaagga
tggggcagcctcagcgactccgattaccagcatttcgtgcggatcatggattctatttac
caaaattttacctga

DBGET integrated database retrieval system