KEGG   Dyadobacter fermentans: Dfer_3935Help
Entry
Dfer_3935         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YtxH RNA_pol_Rpb5_C
Motif
Other DBs
NCBI-ProteinID: ACT95139
UniProt: C6VXV6
Position
4784558..4784890
Genome map
AA seq 110 aa AA seqDB search
MSINAKHLATFILGAAAGVAAHKYLQTEEGEKLLEDLKTKANNLKAEAEGAIDKAPEYFE
ELKTKGAETLKGNFPDAEGFFKDLFEKFKGTKGSASSGTDVTTPTPDPIS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaacgcaaaacacctggccacattcattttgggagccgccgcaggcgtggca
gcacacaaataccttcagaccgaggagggagagaagcttctggaagacctcaaaacaaag
gcgaacaacctgaaagccgaagccgaaggggccatcgataaagctcctgagtatttcgaa
gaacttaaaaccaagggcgccgaaaccctgaaaggcaatttccccgacgcggagggcttt
ttcaaggatctgttcgagaagttcaagggcaccaaaggctccgcatccagcggaacggat
gtgaccacacccacacccgacccgatttcgtaa

DBGET integrated database retrieval system