KEGG   Dyadobacter fermentans: Dfer_3937Help
Entry
Dfer_3937         CDS       T00970                                 

Definition
(GenBank) protein of unknown function DUF985
  KO
K09705  uncharacterized protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_5
Motif
Other DBs
NCBI-ProteinID: ACT95141
UniProt: C6VXV8
Position
4785666..4786172
Genome map
AA seq 168 aa AA seqDB search
MKPASYWIEKLNLLPHPEGGYYAETYWAPETIPQHALPARFGGDRAFSTGIYFLLESHNF
SAFHRIQADEMWHFYAGEALEVFVIDEKTGELTVIRLGNDPDNGETFQAVVPAGAWFGSR
PAAGSSYALVGCTVAPGFDFADFEMAACDALTQQYPQHAALIAGLTHC
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgcttcctactggattgaaaaattaaatctcctgccgcaccctgaaggcggc
tactatgccgaaacctactgggcgcccgaaaccataccgcagcatgcattgcccgcgcgt
ttcggcggcgacagggcattttccaccggcatttacttcctcctcgaatcgcacaacttc
tccgcatttcaccgcattcaggcggacgaaatgtggcatttctatgccggggaagcatta
gaagtatttgtgatagatgaaaaaaccggggagctgaccgtcatccggctcggcaacgat
cctgataatggcgagacgttccaggccgtggtgccggcaggtgcgtggttcggttcacgg
ccggcggccggcagctcgtacgcgcttgtaggctgcaccgtagcgcccggcttcgatttc
gccgattttgaaatggcggcatgcgatgcattaacacagcaatacccgcagcacgccgca
ttgatcgccgggcttacgcattgctaa

DBGET integrated database retrieval system