KEGG   Dyadobacter fermentans: Dfer_3938Help
Entry
Dfer_3938         CDS       T00970                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00430  Taurine and hypotaurine metabolism
dfe00460  Cyanoamino acid metabolism
dfe00480  Glutathione metabolism
dfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Dfer_3938
   00460 Cyanoamino acid metabolism
    Dfer_3938
   00480 Glutathione metabolism
    Dfer_3938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dfe01002]
    Dfer_3938
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Dfer_3938
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     Dfer_3938
Peptidases [BR:dfe01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   Dfer_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ACT95142
UniProt: C6VXV9
Position
complement(4786188..4787954)
Genome map
AA seq 588 aa AA seqDB search
MKLHYALMLLAGSFSGISNAQNPVRESTGFYQFLSDDPNQKPFFSDRKGVIARNGMVAAA
HPVASQVGVDILKAGGNAVDAAVAVQFALAVVHPSAGNIGGGGFLVLRDKDGKSYSIDFR
EKAPGKSHADMYLDKAGNIIPESSTLGRLASGVPGSVDGMVQAHAKFGKLSWKQVLQPAI
DIAANGVVLTEREARSLNAIKSDLLAINPGSSYFLNPAGKDWTAGDLLVQKDLSKVLKRI
QKKGRDGFYAGKVAKQLVKDINRSNEGIISKQDLADYRAQWRETITEGYKGYKVITMAPP
SSGGVALLQLMRLTEQHPLRQWGWHSDSTIQVMIEAERRVYADRAKFLGDPDYVKVPINE
LISSEYLKNRWADFSWDKATDSKNIRGGELPGYESLETTHFSVVDKEGNAVSVTTTLNGG
YGSRVVVKGGGFFMNNEMDDFSIKAGAPNMYGLIGNKANAIAPGKRMLSSMTPTIIERDG
KLLMVVGTPGGSTIITSVYQTILNVLEHGMTMQQAVNALKFHHQWLPDKTTFEANAFSTE
AIQKLQGKGYILEQQRNSIGRMDCILVLPDGSLEGGSDPRGDDTSIGY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacattacgcgttaatgctgctggccggctcattttccggcatttccaacgcc
caaaatcccgtccgggaatccaccggcttctaccagttcctttccgacgatcccaatcag
aaaccgtttttcagcgaccgcaaaggcgtgatcgcgcgcaatggaatggtcgcggctgca
catccggtggcgtctcaagtaggcgtggatattttgaaagcgggcggcaatgccgtggac
gcggcggtagcggtgcagtttgcattagccgtagtgcatccttctgccggtaacatcggc
ggaggcggttttttggtgttgcgggacaaggacggcaaaagttacagcatcgatttccgt
gagaaagcgccgggcaaaagccatgcggatatgtatctcgataaagcgggcaatatcatt
cccgagtccagcacgctgggccggctcgcgtcgggcgtgcccggatcggtggacggaatg
gtgcaggcgcatgcaaaatttggtaaactaagctggaaacaggttttgcagccagccatc
gacattgccgcaaatggggtagtactcaccgagcgcgaggcacgcagccttaatgcgatt
aaaagcgacctgctggccatcaatccgggttcgtcgtacttcctcaacccggccggtaag
gactggacagcgggcgatctgctcgttcagaaggacttgtccaaagttttgaaacgcatt
caaaagaaaggccgtgatggtttctatgctggaaaagtagccaaacagctcgtcaaagac
attaaccgcagcaacgaaggcatcatcagcaagcaggaccttgccgactaccgcgcgcaa
tggcgcgaaaccattaccgaaggttacaagggctacaaggtgatcaccatggcgccgccg
tcgagcgggggcgtagcgctactgcagctcatgcgcctcaccgagcagcacccgctgagg
caatggggctggcacagcgactccaccattcaggtgatgatcgaagcggagcgccgcgtg
tacgccgaccgtgccaagttcctcggcgaccccgattatgtaaaagtgcccatcaacgag
ctcatcagcagcgagtaccttaaaaaccggtgggctgatttctcctgggacaaggccacc
gacagcaaaaacatccgcggcggcgagctacccggctacgagagcctggaaaccacgcat
ttttcggtcgtggacaaggaagggaatgcggtatcagtgaccaccacattgaacggcggt
tatggaagccgcgtggtggtcaaaggcgggggatttttcatgaacaatgaaatggacgat
ttcagcataaaagccggagctccgaatatgtacgggctgatcggcaataaagccaatgcg
atcgcgcccggcaagcggatgctgtcgtcgatgacgcccacgatcatcgagcgggatgga
aaattactgatggtggtcggaacgcccggcggctccacgatcatcacctcggtgtaccag
accatcctgaacgtgctggaacatggcatgacgatgcagcaggccgtgaacgctttgaaa
ttccaccaccaatggctgccggataaaaccacgtttgaagccaacgcattctccaccgag
gctattcagaaattgcagggcaagggctacatcctcgaacagcagcgtaattccatcggc
cggatggactgcatcctcgtcctccccgacggctccctcgaaggcggctccgatcctcgc
ggagatgataccagcattggttattag

DBGET integrated database retrieval system