KEGG   Dyadobacter fermentans: Dfer_3969Help
Entry
Dfer_3969         CDS       T00970                                 

Definition
(GenBank) succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00020  Citrate cycle (TCA cycle)
dfe00190  Oxidative phosphorylation
dfe00650  Butanoate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3969
   00650 Butanoate metabolism
    Dfer_3969
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cation_ATPase_N Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: ACT95173
UniProt: C6VYW7
Position
4820670..4821341
Genome map
AA seq 223 aa AA seqDB search
MSWFSQTLTSSIGKKLLMALTGLFLISFLVIHATINAMIFYNDGGETFSHWGHFMGTNPI
IRTLEIGLVAGFIIHIADGLILWKNNREARPVGYAVSNASANSTWYSRSMGLLGTLLLIF
LVIHTSHFWIPNRSNQFATGEELDLYQMMLDIFQNPIVVLIYVLGCVSLFWHLLHGFKSA
FQSLGLNHVKYNGIISWIGTAFSIVIPILFALMPISIYLGWVK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggttttcacaaacgttaacgagctctatcgggaaaaaacttttgatggctctt
accggactttttctgattagctttctggtgattcatgccaccatcaatgccatgattttt
tacaatgatggcggggagactttttcgcattgggggcacttcatgggtaccaacccgatt
atacgtacgcttgaaatcggcctcgttgcgggcttcatcatccatatcgccgacggtctg
atcctctggaaaaacaaccgtgaggcacgtccggtaggttacgcggtcagcaatgcatcg
gccaacagcacctggtactcgcgcagcatgggcttgctcggaactttgcttttgatcttc
ctggtgatccacacttcgcacttctggattcctaaccggtccaaccagtttgccacaggc
gaggagctggacttgtaccagatgatgctcgatatcttccagaacccgatcgtggtgttg
atttatgtgttgggctgcgtgtcgcttttctggcatttgctgcacggtttcaaaagcgca
ttccagtcgctgggcctcaaccacgtgaagtacaatggcatcatctcgtggattggaact
gcattctcgattgtcattccgatcctcttcgcgctgatgccgatctcgatttatctgggc
tgggtgaagtaa

DBGET integrated database retrieval system