KEGG   Dyadobacter fermentans: Dfer_3970Help
Entry
Dfer_3970         CDS       T00970                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00020  Citrate cycle (TCA cycle)
dfe00190  Oxidative phosphorylation
dfe00650  Butanoate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3970
   00650 Butanoate metabolism
    Dfer_3970
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3970
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dfer_3970
    1.3.5.4  fumarate reductase (quinol)
     Dfer_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO NAD_binding_8 GIDA AlaDh_PNT_C Pyr_redox HI0933_like PALP
Motif
Other DBs
NCBI-ProteinID: ACT95174
UniProt: C6VYW8
Position
4821388..4823376
Genome map
AA seq 662 aa AA seqDB search
MATSSRLDAKIPQGTLESKWSKYRSSVPLVNPANKRNLEIIVVGTGLAGASAAATLAELG
YKVKAFCFQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTIKGGDYRAREANVHRL
AEVSGNIIDQCVAAGVPFAREYGGLLSNRSFGGTQVQRTFYAAGQTGQQLLLGAYSGLQR
QVGMGTVKMYNRHEMLDVVNIDGKCRGIIARNLITGEIERHAGHAVLLCTGGYGNVFYLS
TNAMGSNVTAAWKAHKRGAFFGNPCFTQIHPTCIPVSGEHQSKLTLMSESLRNDGRIWVP
KKQNDTRPGNEIPENERDYYLERRYPAFGNLVPRDIASRAAKERCDAGYGVGTSKLAVYL
DFAAAVERYGRAEANKNNIHNASEADIITWGKAVVKEKYGNLFDMYKQITGEDPYEVPMR
IYPAVHYTMGGLWVDYNLMTTVPGLYSLGEANFSDHGANRLGASALMQGLADGYFVIPYT
IGAYLASEIRTGKISTDHEAFVKAEAEVKERIDTLLRIQGKTSPELFHRRLGKIMWEKCG
MARNAEGLKEAIQEIRQLRRDFWSDVKVMGTANYFNPELDKANRVADFIELGELMCIDAL
DRNESCGGHFREEYQTEEGEALRDDENYMYVSAWEHKGPENWELHKEELVYENIKIAQRS
YK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtcatctcgtctggatgccaaaataccgcaaggaacgcttgaaagtaaatgg
agcaaataccgctcgtcagtacctcttgtaaaccctgccaacaaacgtaacctggaaatc
atcgtggttggaacaggcctcgcaggtgcttcggcggctgctaccctggctgagctcggt
tacaaagtaaaagcgttctgttttcaggattcgccacgtcgtgcgcactcgatcgcagcg
caaggcgggatcaatgcagcaaaaaactaccagaatgacggtgactcggtttaccgtctt
ttttatgataccattaaaggcggtgactaccgggcgcgtgaagcgaacgtgcaccgcctg
gccgaagtttcgggtaacattatcgaccaatgcgtagcggcgggtgtgcctttcgcccgt
gagtacggcggcttgctgtccaaccgctctttcggtggaacgcaggtacagcgtaccttc
tacgcagcgggccagacgggccagcaacttttgctgggagcctattccggcttgcagcgc
caggtgggtatgggtaccgtaaaaatgtacaaccgccacgaaatgctcgacgtcgtgaat
atcgatggcaaatgccgcggtatcatcgcacgtaacctcattacaggcgagatcgaaaga
catgcaggccacgccgtattgctttgtacaggtggttacggaaacgtgttctacctttcc
acgaatgcaatgggcagcaatgtgaccgcggcatggaaagcccacaaacgcggtgcattc
ttcggtaacccttgttttacccaaatccacccgacttgtatccccgtttccggcgaacat
cagtcgaaactgaccctgatgtcggaatcgttgcgtaacgacggccgtatctgggttccc
aaaaagcagaatgatacccgcccgggcaacgaaattcctgaaaacgagcgcgattactac
cttgaacgccgttaccctgcattcggtaacctcgtaccgcgcgatatcgcgtcgcgggcg
gcgaaagaacgttgcgatgccggttacggtgtaggaacttccaagctggccgtttacctc
gatttcgctgcggcggtagagcgttacggacgtgccgaggcgaataagaacaatattcac
aatgcgtccgaagccgacattatcacgtggggtaaggccgttgtgaaagaaaaatatggt
aacctcttcgatatgtataagcaaatcacgggtgaagatccgtatgaagtgcctatgcgt
atctatcctgcggtgcactacaccatgggcggcctttgggtggattacaacctgatgacc
accgtgcccggcttgtactcgcttggtgaggccaacttctccgaccacggcgccaaccgc
ctcggtgcttcggcattgatgcagggccttgccgacggttatttcgtgattccgtacacc
atcggtgcttacctggcgagcgaaatccgtaccggaaagatctctaccgaccacgaagca
ttcgtgaaagcggaagccgaagtgaaagagcgtatcgacacattgctgcgcattcagggt
aaaacatctcctgagcttttccaccgccgtttgggcaagattatgtgggaaaaatgcgga
atggcgcgtaatgcggaaggtttgaaagaagcgatccaggaaatccgtcagctgagaaga
gacttctggtcggacgtgaaagtaatgggaaccgccaactacttcaaccccgaactcgac
aaggcaaaccgcgttgcagacttcatcgaacttggcgagctgatgtgtatcgacgcgctg
gaccgtaacgaatcctgcggtggccactttcgcgaggagtaccagaccgaagaaggcgaa
gcattgcgcgacgacgagaactatatgtatgtatcggcctgggagcacaaaggtcctgag
aactgggagcttcacaaggaagagctggtgtacgaaaacatcaaaatcgctcagcgcagc
tataaataa

DBGET integrated database retrieval system