KEGG   Dyadobacter fermentans: Dfer_3971Help
Entry
Dfer_3971         CDS       T00970                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00020  Citrate cycle (TCA cycle)
dfe00190  Oxidative phosphorylation
dfe00650  Butanoate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3971
   00650 Butanoate metabolism
    Dfer_3971
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3971
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dfer_3971
    1.3.5.4  fumarate reductase (quinol)
     Dfer_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_10 Fer4_9 Fer2 Fer4_4 Fer4_18 Fer4_6 Fer4 Fer4_2 Fer4_22 Fer4_3 Fer4_21
Motif
Other DBs
NCBI-ProteinID: ACT95175
UniProt: C6VYW9
Position
4823452..4824204
Genome map
AA seq 250 aa AA seqDB search
MRLSLKVWRQSNKDAAGGFEEYKLDHVSPDMSFLEMFDVLNEQLIEEGKEPVSFDHDCRE
GICGACSMYINGRPHGPLRGVTTCQLHMRSFNDGDTIVVEPWRAQAFPVIKDLVVDRDAF
DRVISAGGFVSVNTGNAQDANALPIAKEAADDAFAAAACIGCGACVAACKNASAMLFVSA
KISQLALLPQGQAERSIRAEKMVAQMDAEGFGACTNTGACSAECPKEISLENIARMNREY
IGAKFSSSAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtctctcaaagtttggagacaaagcaataaagacgcagcgggaggtttcgag
gaatacaaactggaccatgtttctcccgatatgtcatttcttgaaatgttcgatgtattg
aacgagcaactcatcgaggaaggaaaagaacctgtatcattcgaccacgactgccgcgag
ggtatttgcggggcttgttcgatgtatataaatggccgtccgcatggaccgttgcgcggg
gtaaccacctgccaactgcacatgcgttcgttcaacgacggggatactatcgtggtagag
ccatggagagcgcaggctttcccggtgatcaaagacctcgtggtagaccgtgacgcattc
gaccgcgtgatttctgcgggcggtttcgtatcggtgaacaccggtaatgcacaggatgca
aacgcattgccgatcgcgaaagaagctgctgacgacgcatttgcagcagcagcatgtatc
ggttgcggcgcttgcgtagcggcttgtaaaaatgcttccgcaatgcttttcgtatctgcc
aaaatctcccagctggcattgttgccgcaaggacaggcagaacgcagcatccgcgccgag
aaaatggtcgctcaaatggacgcagaaggcttcggagcctgcaccaacaccggtgcctgc
tcagcagaatgccctaaggaaattagcctcgaaaacatcgcccgcatgaaccgcgagtac
atcggcgcgaaattctcgtcttcggcggtttaa

DBGET integrated database retrieval system