KEGG   Dyadobacter fermentans: Dfer_3972Help
Entry
Dfer_3972         CDS       T00970                                 

Definition
(GenBank) protein of unknown function DUF820
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uma2
Motif
Other DBs
NCBI-ProteinID: ACT95176
UniProt: C6VYX0
Position
4824326..4824904
Genome map
AA seq 192 aa AA seqDB search
MDTVELRYKPLRLDDEFYEFCRENDQLKIERDSEGTLYIISNSGGTTGILNSIINYWLMH
WHLARNLGHVFDSSTAFRLPNTSVRSPDASWVSNEKWEYLTDAEQTKFPPVCPDFVIELL
SANDDLHTIQKKIQSEWIENGCSLAWLIDPFTETAYVYRPNADVEAVSGFSQLLSGGNVL
EGFEFDLSKLKI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggatacggtagaattgagatacaagcctctgcgtcttgatgatgaattctacgagttt
tgccgggagaatgatcaactcaaaatagagagggatagcgaaggaacgctctatattatt
tcaaatagtggcggaactacgggaatcttgaattcgatcatcaactactggctgatgcat
tggcaccttgcgaggaatttgggccatgtttttgattcatcgacagcttttcgtcttcct
aacacctcggtaagatctcctgacgcctcgtgggtctccaatgaaaaatgggaatacctg
acggacgccgaacaaacaaagtttccacctgtttgtcctgactttgtgattgagttgcta
tcagcaaatgatgatttacacaccattcagaaaaagattcaaagcgaatggattgaaaac
ggatgcagcctggcttggcttatcgatccatttacagagacagcttatgtgtatcgaccg
aatgcggatgtcgaggctgtcagcggattcagccagctattatcggggggaaacgtgctt
gaaggctttgaattcgatttaagcaaactcaaaatataa

DBGET integrated database retrieval system