KEGG   Dyadobacter fermentans: Dfer_3984Help
Entry
Dfer_3984         CDS       T00970                                 

Definition
(GenBank) SNARE associated Golgi protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc UPF0016
Motif
Other DBs
NCBI-ProteinID: ACT95188
UniProt: C6VYY2
Position
4833546..4834178
Genome map
AA seq 210 aa AA seqDB search
MTIVPLVTTSVLTAWAINHEKLLRDLPIEWWVGVTFILTLASASALTPPTFLALVYGYFL
GWTSLPMLFGLNVGAIAIIYISANFLHAASVRGYLIQIYPQVGSLLRRFYKNELRLIFFA
KLSPVLPFAITNLFFAMAGARFKQVLTGGTLGMIPRTMLAVWAGKEAQDIRYLLEHPNEG
LATKIVLIVLIIISTVGIGYFFKDKSMVES
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgtgccgttggtgacgacctccgttctgacggcctgggcgatcaatcatgaa
aagctactgcgtgatttgcctatcgaatggtgggtaggggtgacgtttattcttacgctg
gcgtcggcctcggcgcttacgcctcctacattcctggcattagtttacggctattttctg
ggctggacttccttgccgatgcttttcgggctgaatgtgggcgcgatcgcgatcatttat
atatcggccaacttcctgcatgcggcgtcggtgcggggctatctcattcagatttacccg
caggtagggagcttgctgcggcggttttacaaaaatgagctgcggttgatctttttcgcc
aaattatcgcctgtgctgccgtttgcgatcactaacctcttttttgcgatggccggggcg
cggttcaagcaggtgcttacgggtggaacattagggatgatcccgcgtacgatgctggcc
gtgtgggcggggaaagaggcgcaggatatccgctacttgctcgaacatcccaatgaaggt
ctggcgacaaaaatcgtgctgatcgtgctgatcattatttcaaccgtaggcatcggatat
ttcttcaaagacaagagcatggtagaatcatag

DBGET integrated database retrieval system