KEGG   Dyadobacter fermentans: Dfer_3985Help
Entry
Dfer_3985         CDS       T00970                                 

Definition
(GenBank) SSS sodium solute transporter superfamily
  KO
K03307  solute:Na+ symporter, SSS family
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: ACT95189
UniProt: C6VYY3
Position
4834305..4835888
Genome map
AA seq 527 aa AA seqDB search
MKSLPFIDLLIVIAYLAGMVAVGIYFSRKNTDADQFTKASGRIPGWAIGISIYATFLSSN
TFLGVPGKAFGSNWSSFVFSLSMPFAAWVATRFFIPFYRSTGEVSAYTHLEHRFGPWART
YAVVCFLLTQLARMGSIFFGIALSLQALTGYPMSTIMVVVGICIVLYTVMGGMEAVIWTE
VVQGVIKTVGALVILYLVVTGVSGGMPSIVEIGKANDKFSLGTLAPDFTTASFWVILLYG
FFMNLNNFGMDQNYVQRYHTTASAKEAASSVWLCVYLYVPVSLIFFLLGTCLFAYYQGNP
ELLQTIKMQVAAEKLPGGTSDAITSLAATLTPADYGDKVMPHFMVTKVPVGLLGLIIAAI
MSAAMSTISSGMNASATVFSVDIYQKYINPDLTPKQSLRLLYVATTVFGLLGMVTGIAMI
GVKSVLDVWWMLSGIFAGGMLGLFLLGMISKSTKNTEALTATIIGIIVIVWMTFSTQLPD
SYSVLRNPLHQNMIMVVGTLTIFLAGVLLTRLRRKQPSEKEVLLPSK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccttacctttcattgacctcctcattgtaattgcctacctcgcagggatggtg
gctgtcgggatttatttttcgcgaaaaaataccgatgccgaccaatttaccaaagcctcg
ggccgcattcccggctgggcgatcggtatttcgatatatgctacttttttgagcagtaat
acctttctgggtgtgccgggcaaggcgttcggcagcaactggagttctttcgtgttcagc
ttatcgatgccgtttgcagcctgggtggctacccggtttttcataccattctaccgcagt
accggcgaagtttcggcttacacccatcttgaacaccgttttgggccgtgggcgcgcact
tacgcggtggtttgcttcctgctcacccagctcgcacgcatgggttcgatctttttcggc
atcgcattgagcttgcaggcgcttacaggttaccccatgtcgacgatcatggtcgtggtg
ggcatttgcattgtgctgtacaccgtaatgggcggtatggaagcggtgatatggacggag
gtggtacagggcgtgatcaagaccgtgggcgcattagtgattctttatctggtagttacg
ggcgtttcaggcgggatgccgagcattgtcgagatcggtaaggccaatgacaaattcagc
ctgggtacgctggcgccggattttacgacggcatccttctgggtgattttgctttacggg
tttttcatgaacctgaataactttggaatggaccaaaactacgtacagcgctaccacacc
acggcttcggcgaaggaggcggcgagttcggtctggctttgtgtgtatttgtatgtgcct
gtttcgctgatattctttttactcggaacctgcctttttgcttattaccagggcaatccc
gagttgctccaaaccattaaaatgcaggtagcggctgaaaaactgcccggcggaacgtcg
gatgcgatcaccagcctggctgccacgctcacgcctgccgactatggcgataaggtaatg
ccgcatttcatggtgacgaaagtgcccgtggggcttctgggcctgattatcgccgcgatc
atgtcggctgccatgagcacgatcagctcgggaatgaatgcctctgcaacggttttttca
gtggatatttatcaaaaatatatcaatccggaccttacaccgaagcaatcgcttcgcctg
ctctatgttgctaccaccgtattcggcttgctgggaatggtgacgggcattgcgatgatc
ggcgtcaaaagcgtgctggatgtgtggtggatgctttcagggattttcgcgggcgggatg
cttggattgttcctgctgggcatgatttccaaaagtacaaagaataccgaggcgctcacc
gccacaattatcgggattatcgtgatcgtgtggatgacattttcgacgcaactgcctgac
agttattcggttttgcgcaacccgctccatcagaacatgatcatggtggtaggaaccctg
acaatctttttggccggcgtgctgctcaccaggctgagacgcaagcagccctcagaaaaa
gaagtgcttttaccaagcaaataa

DBGET integrated database retrieval system