KEGG   Dyadobacter fermentans: Dfer_3990Help
Entry
Dfer_3990         CDS       T00970                                 

Definition
(GenBank) General substrate transporter
  KO
K03761  MFS transporter, MHS family, alpha-ketoglutarate permease
Organism
dfe  Dyadobacter fermentans
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dfe02000]
    Dfer_3990
Transporters [BR:dfe02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    Dfer_3990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like TRI12
Motif
Other DBs
NCBI-ProteinID: ACT95194
UniProt: C6VYY8
Position
complement(4838844..4840139)
Genome map
AA seq 431 aa AA seqDB search
MEQTLHKDDTGWRLRAIIGGSAGNLVEWYDWYAYSAFSLYFANTFFPDSNPTVQLINTAG
IFAVGFLMRPIGGYVFGKLADNRGRKVAMTVSVLLMSLGSLLIAFLPGYNSIGVAAPLLL
LLARLLQGLSVGGEYGTSATYLSEVATEAKRGFFSSFQYVTLIGGQLIALGLQLILQNIF
LTDQQMHDWGWRIPFVIGALLSLVALYLRAHLNETEAFQSKDPKTKKEGSLRELMKHPKA
VLVVVGLTAGGTLAFYTYTTYMQKFLVNTVGLTKYQSTLLTFCSLFIFAALQPVFGALSD
RIGRRPLLIAFGVLGTIFTYPLLATLSHTTGMWPAFGLLMAALIIVSGYTSINAVVKAEL
FPVEVRALGVGLPYSIAVAVFGGTAEYFALWAKNIGHETWYYWYVTACIFASLIVYIRMK
DTKHTSLIEKH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaactttacacaaagacgacaccggctggcgcctcagagccattatcggcgga
tcggccggcaatctcgtcgaatggtacgactggtacgcctattccgccttctctctctat
ttcgccaatactttcttcccagattccaatcccacggtccagctgatcaataccgccggc
attttcgcagtgggtttcctgatgcggccgatcggcggctatgtttttggcaaactggcc
gataaccgcgggcgaaaggtggccatgaccgtgtcggtgctgctgatgtcgcttggctcg
ctgctgattgcattcctgcccggctataacagcatcggcgtggcggctccgcttctgctg
ctgctcgcccgcttgctgcaaggccttagtgtgggcggggaatatggtacttcggccacc
tacctcagcgaggtggctacggaggcgaaacgtggtttcttttccagttttcaatatgtg
acgctcattggcggacagcttattgcattgggtttgcaactcattttacaaaacattttc
ctcaccgaccagcaaatgcacgactggggctggcgcattccgttcgttatcggagcattg
ctttcgctcgtagcattgtacctccgcgcgcatctgaacgaaaccgaagcatttcaatcc
aaagatcccaaaacaaaaaaggaaggctcgctgagagagcttatgaagcatccgaaggcc
gtgttggtggtcgtggggcttaccgcgggcgggacactcgcattttacacctacaccaca
tacatgcagaagttccttgtgaacacggtggggctcacaaagtaccagtcgactctgctt
actttttgctctttgttcatcttcgcggcattgcaacccgttttcggggcgctcagcgac
cgcattggccgccgcccgctgctgatagcattcggcgtgctgggaacgatttttacctat
ccgctgctagctacgctcagccacactacaggcatgtggcccgcattcgggctgctcatg
gccgcgttgatcatcgtgagcggttatacctccattaatgccgtggtgaaagccgaactt
tttccagtggaagtgcgtgcgctgggtgtagggctgccctactccattgcggtggccgtg
tttggcggcacggcggaatactttgcattatgggccaagaatatagggcacgaaacctgg
tactactggtatgtgacggcctgcattttcgcttcgctcattgtttacatccgcatgaag
gacaccaagcacacttcgctcatcgaaaagcattga

DBGET integrated database retrieval system