KEGG   Dyadobacter fermentans: Dfer_3991Help
Entry
Dfer_3991         CDS       T00970                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ACT95195
UniProt: C6VYY9
Position
complement(4840164..4840958)
Genome map
AA seq 264 aa AA seqDB search
MSDHFSKNLPYTQLGSGPHILLAFHGIGQDGSSCFAPMLKSLGQHYTIYAFDLPFHGQNS
DAPFEVISKTAWKVSIQSYLSQNNISRFDIAGFSIGGRFALATLEAFPEQIDNAFLIAPD
GVTEHPMFALATRIPPARWIYGWLMRHPNVFFPGVQAARTLKLASKSLVRFTQQVLNTPE
KRQTIYRSWVAFRDLRFDIPALVKVANAHQVTIYLFAGEYDSLLKPKAVKKLADLLPENQ
YIELKSGHTRLVEHAAAWICTLFK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccatttttccaaaaacttaccgtacacccaactaggctccggccctcatatt
ctcctcgctttccacggaattgggcaagatggctcctcatgcttcgcgccaatgctcaaa
tcgctcggtcagcactacaccatctacgcattcgatctgccatttcacggccaaaacagt
gacgctccgtttgaagtcatttcaaaaacagcctggaaggtcagtattcaatcttatctg
agtcaaaacaacatttcccgcttcgatatcgccggtttcagcatcggcgggcggtttgca
ttggccacgctggaagcatttcctgaacaaatcgacaatgcattcctcattgcgcccgac
ggcgtaacggagcacccgatgttcgcgctggcgacgcgcattccgcctgcgcgatggatt
tatggctggctaatgcggcatcccaatgtgttttttcccggtgtacaggcggcgcggacg
ttgaaactggcgagtaaaagtctcgtacggttcacgcagcaggttttgaatacccctgaa
aaacggcagaccatttaccgttcatgggttgcattccgggatttgcggtttgatattccg
gcattggtgaaggtggctaacgctcatcaggtgacgatttacctttttgcgggcgaatac
gatagtctgctgaaaccgaaggcagtcaaaaagttggccgatctgcttcccgagaatcaa
tatatagaacttaaaagcggccatacccgcctggtggaacatgcggctgcgtggatttgc
actttatttaagtaa

DBGET integrated database retrieval system