KEGG   Dyadobacter fermentans: Dfer_3997Help
Entry
Dfer_3997         CDS       T00970                                 

Definition
(GenBank) YdjC family protein
  KO
K03478  chitin disaccharide deacetylase [EC:3.5.1.105]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.105  chitin disaccharide deacetylase
     Dfer_3997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdjC DUF4453
Motif
Other DBs
NCBI-ProteinID: ACT95201
UniProt: C6VYZ5
Position
complement(4844941..4845936)
Genome map
AA seq 331 aa AA seqDB search
MKKLLFLLAILPSMSAFAQTEPTYAEKLGYPKGKKVLIIHVDDVGMSYESNQGAIRAIRE
GVANSLSVMMPCGWVPGFVHYWKENKDIDAGLHLTMTSEWKDYRWGPLAGKTNVKGLTDS
EGALWRSVADVVKNASPDEVETEIRAQLERARTMGFEPTHLDSHMGTLFATPEFLERYLK
VGMQEKIPVMFPGGHNTAIRGEEKMIDKQFEMTQKVGKQLWEAGLPVLDDLENSSYGWKG
PANGDKSEKALQQYKTAKYIEAIGKLKPGLTMVIMHCTIHTEVFPHISDSWPTREGDFLA
MIDPQLRKYIEKEGIVLTTWREAMQRRQKVK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctattcctgctagccattcttccttccatgtctgcatttgcacaaacc
gaacctacttacgccgaaaagcttgggtatccgaaaggcaaaaaagtcctcattatccac
gtcgacgatgtgggcatgtcgtacgaatccaatcagggcgctatccgggctattcgcgag
ggtgttgctaattcgttgagcgtgatgatgccttgcggctgggtgcccggttttgtgcat
tattggaaagagaataaggatatcgacgccgggttgcatttaaccatgacttccgaatgg
aaagattaccgctggggcccgctggccggcaaaacgaatgtaaaaggcctcaccgactct
gagggcgcattgtggcgaagcgtggcggatgtggtgaaaaacgcttcgccggacgaagta
gaaactgaaatccgcgcacaactggaacgcgcccgcacaatgggcttcgagcccacgcac
ctcgattcgcatatgggcacgctcttcgcgacgccggagtttttggaaaggtatttgaaa
gtcggaatgcaggaaaaaatccccgtcatgttccccggcgggcacaatacggccattcgc
ggcgaagaaaaaatgatcgacaagcaattcgaaatgacccagaaagtaggaaaacaactc
tgggaagccggcctgcccgtcctcgacgacctcgaaaacagcagctacggctggaaaggc
cctgcaaacggcgacaaatccgaaaaagcattacagcaatacaaaaccgccaaatacatc
gaagcgatcggcaagctgaaacccggcctcacgatggtgatcatgcattgcacgatccac
accgaagttttcccccacatctccgactcctggcccacccgcgaaggcgatttcctggcc
atgatcgatccgcaattgcggaagtatattgagaaagaaggcattgtgctgacgacctgg
cgggaggcgatgcagcgccgacagaaggtgaagtaa

DBGET integrated database retrieval system