KEGG   Dyadobacter fermentans: Dfer_4011Help
Entry
Dfer_4011         CDS       T00970                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07658  two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP
Organism
dfe  Dyadobacter fermentans
Pathway
dfe02020  Two-component system
Module
dfe_M00434  PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dfer_4011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dfe02022]
    Dfer_4011
Two-component system [BR:dfe02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   Dfer_4011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACT95215
UniProt: C6VZ09
Position
complement(4862576..4863286)
Genome map
AA seq 236 aa AA seqDB search
MSTAKSANSAPKVLVVDDDSDIVELLEYNLTKEGYSVLTASNGKKAIDIAKAFVPDLILL
DIMMPQLDGIETGRILRQNPDIKNTYILFLTARSEEYSEVAAFEVGADDYITKPIKPRAL
MSRINALFRREAQKAESGDTIEILDLSINRKNYTVTQGGEKSTVLPKKEFELLFFLAQTP
NKVFSRDELLQKIWGADIYVLERTVDVHIRKLREKLGDTYIKTLKGVGYMFSNERE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgctaaatctgcaaactcggctccgaaagtactggtagttgacgacgattcc
gacattgttgaacttctcgaatataacttaaccaaggaaggctattcggtactgaccgcc
tccaacggaaagaaggctatcgacatcgccaaggcattcgtacccgatctcatcctcctc
gacatcatgatgccccaactcgacggcatcgaaaccggcaggatattgcgccagaatccc
gacatcaagaacacctatatcctgtttctgaccgcgcgctccgaggaatattcggaagta
gctgcgtttgaagtaggtgccgacgattacatcaccaagccgatcaagccgcgtgcgctc
atgagccggatcaatgcattgttccgtcgcgaagcccagaaagcggagtcgggcgatacg
atcgagatcctcgatttgtccattaaccgcaagaactatacggtaacccagggcggcgag
aagtcgactgttttgcctaaaaaagaattcgaactgctgtttttcctggcacaaacgccg
aacaaggttttcagccgcgacgaattgctgcaaaagatctggggggcagatatttatgtg
ctcgaaaggaccgtggatgtccatattcgcaaactgcgcgaaaagctgggcgatacttat
atcaaaactttgaagggcgtaggctatatgttcagcaacgagcgcgaataa

DBGET integrated database retrieval system