KEGG   Dyadobacter fermentans: Dfer_4015Help
Entry
Dfer_4015         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT95219
UniProt: C6VZ13
Position
complement(4865940..4866440)
Genome map
AA seq 166 aa AA seqDB search
MYIPFSDIDFQSRVWVYQADRELTPEETGIITETLKASLDNWEAHGKPLTASGKVFEHRF
VVVAVDERDELPSGCSIDKSVHWLQEIGQRMNIDFFDRSLAYIDEHDAIRTIPVPKIKQA
IMTEAILPTTTIFDNQVTTKAQWMSRWKVAASNSWLNRYFTEQTSI
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcccttttagtgatatcgattttcaatcccgggtatgggtctatcaggccgac
agggagctgacacccgaagaaacgggcattatcaccgaaaccctgaaagcttcattggac
aactgggaagcgcacggaaaaccacttacggcttccggaaaagtatttgaacaccgcttt
gtcgtagttgccgtggacgagcgcgatgagctgccgagcggctgttcaatcgacaaatcg
gtgcattggttgcaggaaatcgggcaacggatgaatatcgacttcttcgaccgctcattg
gcctacatcgatgagcacgatgcgatccggacgatcccggtgccgaagatcaagcaggcg
attatgactgaggcgattctgcctacgactaccatcttcgataaccaggtcaccacgaaa
gcgcagtggatgagccgctggaaagtggcggcgtccaattcatggctgaaccgttatttt
acggagcaaacgagtatataa

DBGET integrated database retrieval system