KEGG   Dyadobacter fermentans: Dfer_4025Help
Entry
Dfer_4025         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-ISL3
Motif
Other DBs
NCBI-ProteinID: ACT95229
UniProt: C6VZ23
Position
4876615..4876974
Genome map
AA seq 119 aa AA seqDB search
MNALQESYLALVRFLLPEGILDYFELSKIVEGLTGLHIYLEEKNLPPSEYKDQKLESKGF
LPEIYIQDFPIRNQKVTLCIKRRRWEVKDTGEIISRDWNVVQQGTRMTKEFADFLKTMY
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcattgcaagagtcttatttagccctagtccgcttcctgttacctgagggtatc
ctcgattatttcgaactttccaaaatcgttgaaggcctcactggtctgcatatctacctg
gaagaaaagaatcttcctccttccgagtacaaagatcaaaaattagagtcgaagggcttc
ctgcccgagatttacatccaagattttcccattcgcaatcagaaggttacactttgcatt
aagcgtcggcgctgggaagtcaaggatacgggtgagattatcagcagagattggaatgtt
gtgcaacaggggactcggatgaccaaagagttcgctgactttttaaaaacaatgtattga

DBGET integrated database retrieval system