KEGG   Dyadobacter fermentans: Dfer_4030Help
Entry
Dfer_4030         CDS       T00970                                 

Definition
(GenBank) Ankyrin
  KO
K06867  uncharacterized protein
Organism
dfe  Dyadobacter fermentans
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Dfer_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-ProteinID: ACT95233
UniProt: C6VZ27
Position
4879728..4880393
Genome map
AA seq 221 aa AA seqDB search
MKTILLLLLAGMFASCNANDQPVTNEMNMRQDNLIELVTKNDLEGMKKALAAGANVNTRD
NRGRTLLLLATIDKQTAMATLLAENGADANLQDDIHDSPFLYAGATGQTELVKIFLARGA
RFDIFNRYNGTALIPACERGHVETVKVLVGTKGFPVNHVNRLGWTALMEAIVLGNGSKKY
QEIVQILKDGGADVGIPDHDGVTPLQHARNRGFAEIVKILE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatattgctgcttctgctggcgggtatgtttgcatcttgtaatgcgaatgat
cagccggtcacaaacgagatgaatatgcgacaggacaacttaatcgagctggtaacaaaa
aacgacctcgaaggcatgaagaaggcgctcgctgccggagctaatgtaaatacaagggac
aatcgtggacgtacgctcctgttgttggcgactatcgacaaacaaacggcgatggccacg
ctgctcgccgagaatggcgctgatgccaatttgcaggatgatattcacgacagcccgttc
ctttacgcaggggctaccgggcaaacggagctggtgaaaattttcctggctcgtggcgcg
cggtttgacattttcaaccggtacaatggaaccgcattgatccccgcatgcgaacgcgga
cacgtggaaaccgtgaaagtgctggtcggcacgaaaggcttcccggttaatcatgtgaat
cggctcggctggaccgcattaatggaagcgatagtgttgggaaacggaagtaaaaagtat
caggaaatcgtgcagatcctcaaagatgggggtgccgatgttggaattcccgaccacgac
ggtgtcacaccgttgcagcacgccagaaatcgcggttttgctgagattgtgaagattttg
gaatga

DBGET integrated database retrieval system