KEGG   Dyadobacter fermentans: Dfer_4039Help
Entry
Dfer_4039         CDS       T00970                                 

Definition
(GenBank) NADH-ubiquinone oxidoreductase chain 4L
  KO
K00340  NADH-quinone oxidoreductase subunit K [EC:1.6.5.3]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00190  Oxidative phosphorylation
dfe01100  Metabolic pathways
Module
dfe_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_4039
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Dfer_4039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q2 DUF716 ATP1G1_PLM_MAT8 UPF0223
Motif
Other DBs
NCBI-ProteinID: ACT95242
UniProt: C6VZ36
Position
4891089..4891400
Genome map
AA seq 103 aa AA seqDB search
MTTVPVQYYLIVAAALFSIGLAIAITKRHYIGMLLGIELMLNAVNINLVAFGRHDPEQLS
GQLFALFVIVVAAAEVTVALAIILRVYGHFKTVDPDKVNELKQ
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtacctgttcaatattatctgattgtcgcggcagctttgttcagcattggt
ttggccattgccattaccaaacggcattacattggtatgttattggggatagagttgatg
cttaatgccgtcaatatcaatctggtagcatttggaagacatgatcctgagcaattgagc
ggccagctgtttgcattgttcgtgattgtcgttgcggcggcggaggtgactgtggccctg
gcgattattctgcgggtgtacggccatttcaaaaccgtcgatcccgataaggtgaatgaa
ttgaagcaataa

DBGET integrated database retrieval system