KEGG   Dyadobacter fermentans: Dfer_4041Help
Entry
Dfer_4041         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT95244
UniProt: C6VZ38
Position
complement(4891951..4892448)
Genome map
AA seq 165 aa AA seqDB search
MTQFNTIRKACLAFVLFLTATFAQAQGTLNDIAFLDGRWLGTYNGGPIEASWTAPKGNNI
VGFIRMIKDDKPALYEIFAFEQTDKGPVAMVKHFKPGMISLEEKEVADRYKFIEAKKNEA
LFEKDDASVRIIYERRSPTQLVIQRGKKENDKWSFVDLFIFNKIP
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacccaattcaacacaatcagaaaggcttgcctggcatttgtacttttcctcacggcc
acattcgcgcaggcgcaaggcacgctgaacgacatcgcattcctcgacggtcgctggctg
ggaacctacaacggcggcccgatcgaagcttcctggactgcgcctaaaggcaacaacatc
gtcggctttatccgcatgatcaaggatgacaagcccgctctttatgagatatttgcattc
gagcagactgacaaaggaccggttgcgatggtgaagcacttcaaacccggcatgatttct
ctcgaagaaaaagaagtagccgaccgttacaaattcattgaagccaaaaagaacgaggcg
ttgtttgaaaaagacgatgcttcggtgcggatcatatatgagagacgctctcctacccag
ctcgtgattcagcgcggcaagaaggaaaacgataaatggagctttgtagacttgtttatt
ttcaacaagattccctga

DBGET integrated database retrieval system