KEGG   Dyadobacter fermentans: Dfer_4043Help
Entry
Dfer_4043         CDS       T00970                                 

Definition
(GenBank) Amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00230  Purine metabolism
dfe00250  Alanine, aspartate and glutamate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
Module
dfe_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dfer_4043
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dfer_4043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dfe01002]
    Dfer_4043
Enzymes [BR:dfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     Dfer_4043
Peptidases [BR:dfe01002]
 Cysteine Peptidases
  Family C44
   Dfer_4043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 GATase_4 Pribosyltran GATase_2
Motif
Other DBs
NCBI-ProteinID: ACT95246
UniProt: C6VZ40
Position
complement(4893756..4895648)
Genome map
AA seq 630 aa AA seqDB search
MSDAIKHECGIALIRLRKPYQYYIDKYETPLYAVHKLSVMMEKQVNRGQDGAGVANIKID
VPPGKRYISRYRSVEPQPLTDIFSKIHKKFRKGLKNNRDHANDAQWLQENLAFTGEVWLG
HLRYGTHGSNEVENCHPMLRQSNWRSRNLVMAGNFNMTNVDELFGKLVSLGQHPKEKVDT
VTVMEKIGHFLDEENQRVFERFKGIYENPTLSDVIEDNIDLPRLLYRSCRDFDGGYAMCG
LTGYGASFVIRDPAGIRPAFYYADDEVVVVASEKQAIKAAFNVDYNQITEITPGSALIVD
KNGEYNEFPILPRLEKRSCSFERIYFSRGTDPDIYNERKQLGKLLIPQILKEVNYDLDNT
IFSYIPNTAETAFLGMIEGLEEYLAKKRKQAIMEGILFEADLEKVLSFRPRIEKLVTKDV
KSRTFITADALRDDMVSSVYDTTFEVVRKNVDTVVIIDDSIVRGTTLEKSILTMLDRLKP
KKIVVASSAPQIRFPDCYGIDMSRMKDFVAYRAVLKLLEERDMEYMLEDVYTQSVTALAT
KNPYNTNFVKSLYDPFTDEEISQKIAEIIRPKGLNAELSVVFQTVENLHKACPGHLGDWY
FTGNYPTQGGNKVVNKAFTNSFEGKLERAY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccattaagcatgagtgcggcatagcacttatccgtcttagaaagccttat
caatactacatcgacaagtacgaaacgccgctgtacgcagttcataagctttcggtgatg
atggaaaaacaggtcaaccggggccaggatggagccggggtagccaacatcaaaatcgac
gtcccgcccgggaaacgatacatcagccgatacagatccgtagaacctcagccacttacg
gatatcttctccaaaatccacaaaaaattccgcaagggtcttaaaaacaacagagaccac
gccaacgatgcgcaatggttgcaggaaaacctggcattcacgggagaagtatggctggga
catctccgctacggcacgcacgggtctaacgaagtcgaaaactgtcacccgatgctgcgc
caaagtaactggcggagccgcaacctggtgatggcgggcaacttcaacatgaccaacgtg
gatgagcttttcggcaaactggtctcgttgggccagcacccgaaagagaaagtggacacc
gtaacggtaatggaaaaaattggacatttcctggatgaagaaaaccagcgggtgttcgag
cgcttcaaggggatttacgaaaacccgacattatcggacgtgatcgaagataatatcgac
ctgccgcgcctgctctaccgctcctgccgcgatttcgacggcggctatgcgatgtgcgga
ctcacgggttatggcgcgtcgttcgtcatccgcgaccctgctggcatcaggcccgcattc
tattatgctgatgatgaggtagtcgtagttgcatctgaaaaacaggcgattaaggctgca
ttcaatgtggattacaatcaaatcaccgaaatcacgccgggttccgcactgattgttgat
aaaaatggggagtacaatgagttcccgatcctgccacgtctcgaaaaacggtcgtgcagc
ttcgagcgcatttacttctcccgcggtaccgacccggatatctacaacgagcgcaagcaa
ttgggtaaattgctgatcccgcaaattctcaaagaagttaattacgacctcgacaacacg
attttctcctacattccgaataccgctgaaacggcgttcctggggatgatcgaaggtttg
gaagaatacctggccaaaaaacgcaagcaggccatcatggaaggcattcttttcgaagcc
gaccttgaaaaagtgctttctttccgcccacggatcgagaaactggtaacaaaagacgtc
aaatcccgtacattcatcaccgccgacgcactgcgcgacgatatggtttcgagcgtgtac
gacacgactttcgaggtggtgcgtaaaaatgtggataccgtcgtaatcatcgacgactct
atcgtacgaggtactactttggaaaagagcattttgaccatgctcgaccgtctcaaaccg
aagaagattgtggtagcgtcatccgcaccgcaaatccgcttcccggattgctacggtatc
gatatgtcgcgaatgaaagactttgtcgcttaccgtgcggtattgaagcttctcgaagag
cgcgatatggaatacatgctcgaagatgtttatacacaaagcgttacggctctcgctact
aaaaatccatacaataccaacttcgtaaaatcgctgtacgatcctttcaccgacgaagag
atttcacagaaaatcgccgagatcatccgtccgaaaggcctgaacgccgaactctcagtg
gtattccaaacagttgaaaaccttcacaaagcctgcccgggacacctcggcgactggtat
ttcaccggaaactaccctacgcaaggcggaaataaagtggtcaacaaagcttttacgaat
tcttttgaagggaaattggaaagagcttattaa

DBGET integrated database retrieval system