KEGG   Dyadobacter fermentans: Dfer_4049Help
Entry
Dfer_4049         CDS       T00970                                 

Definition
(GenBank) ABC transporter related
  KO
K06861  lipopolysaccharide export system ATP-binding protein [EC:3.6.3.-]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe02010  ABC transporters
Module
dfe_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dfer_4049
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dfe02000]
    Dfer_4049
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Dfer_4049
Transporters [BR:dfe02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    Dfer_4049
 Other Transporters
  Pores ion channels [TC:1]
   Dfer_4049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N FliG_N AAA_21 BCA_ABC_TP_C DUF148 AAA_23 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACT95252
UniProt: C6VZ46
Position
complement(4898753..4899484)
Genome map
AA seq 243 aa AA seqDB search
MILRTVNLVKKYGVRLVNNNVSYQVEQGEIVGLLGPNGAGKTTSFYMAVGLVKPNSGNVY
LDDKDITNLPMYKRARLGLGYLAQEASVFRTLTVEENIKAVLEMTNLSKADQKQKVEELI
EEFHLGHVRKSKGMVLSGGERRRTEIARSLAVDPKFILLDEPFAGVDPIAVEDIQSIVAK
LKHKNIGILITDHNVNETLSITDRAYLLFEGKILKQGTAEELAEDEVVRRVYLGQNFELK
RKI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatactaagaaccgtaaacctcgtgaagaaatacggggttcgacttgttaataataat
gtaagctaccaggtcgagcagggcgagatcgtggggctgctggggccgaatggcgcgggc
aaaacgacttccttttatatggccgttggattggtgaaaccgaacagcggaaatgtgtac
ctcgacgataaggacattaccaacctgccgatgtacaagcgcgcgcgcctgggcctgggc
tacctcgcgcaggaagcgtcggttttcaggacattgacggtcgaagagaacatcaaagcc
gttctcgaaatgaccaatctttcgaaagccgatcaaaaacagaaggtagaggagctgatc
gaggaatttcacctcgggcacgttcgaaaaagcaagggtatggtcctttcgggaggtgag
cgccgccgtacggaaattgcaaggtcactggccgtagacccgaagttcattctactcgat
gagcctttcgcgggtgtggaccccattgccgtggaagatattcaaagtattgtagccaag
ctgaaacacaaaaacatcggcatcctcatcacggaccacaatgtaaacgagacgctatcg
atcaccgaccgtgcatatctgctgtttgaaggaaaaattttgaaacaaggcactgccgaa
gaattggcggaggacgaagtggtgaggcgcgtgtacctgggacagaatttcgagttgaag
cggaagatctga

DBGET integrated database retrieval system