KEGG   Dyadobacter fermentans: Dfer_4052Help
Entry
Dfer_4052         CDS       T00970                                 

Definition
(GenBank) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
dfe  Dyadobacter fermentans
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dfer_4052
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     Dfer_4052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase SEA
Motif
Other DBs
NCBI-ProteinID: ACT95255
UniProt: C6VZ49
Position
4901797..4902381
Genome map
AA seq 194 aa AA seqDB search
MIYPIVAYGDPILRKPTRFIEKDEVDLKKLSEDMFETMHGANGVGLAAPQIGLNIRIFVV
DGTPFAERDEDDDDEPDLSLVDFKKTFINPEILEETGEEWGFEEGCLSIPGIRGDVYRPE
TLRIRYRDLDWNEHEETYSGMAARIIQHEYDHLLGKLFVDYLPTLKKQFIKKKLTDISKG
NVDADYRMRFPGRR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttatccaatagttgcatacggtgaccccatcctgagaaagccgacccgttttatc
gagaaagatgaagtggatttgaagaaactttcagaggatatgttcgaaactatgcacgga
gcgaacggcgttgggcttgcggccccgcagatcggtctgaatatccgcattttcgtagtg
gacggcacgccgttcgccgaaagagatgaggacgatgacgacgagccggatctgtcattg
gtcgatttcaaaaagacattcattaatcccgagatattggaggaaaccggcgaggaatgg
ggattcgaagaaggctgcctgagcattcccggcatccgcggagatgtgtaccgccccgaa
acgctccgcatccgctaccgcgacctcgactggaacgagcatgaagaaacctattccggc
atggcggcccgcattatccagcacgaatacgaccatttgctgggcaaactgtttgtagat
tacctgccgacgctcaaaaagcagtttatcaaaaagaaactgaccgatatttccaaagga
aacgtagatgccgactaccgcatgcgttttccgggccggagataa

DBGET integrated database retrieval system