KEGG   Dyadobacter fermentans: Dfer_4056Help
Entry
Dfer_4056         CDS       T00970                                 

Definition
(GenBank) Biopolymer transport protein ExbD/TolR
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ExbD DUF4969 Internalin_N MotB_plug
Motif
Other DBs
NCBI-ProteinID: ACT95259
UniProt: C6VZ53
Position
4905039..4905653
Genome map
AA seq 204 aa AA seqDB search
MAKVRPKKHAPHTDMTAMTDVAFLLLTFFIMTATFKSNDAEITTPTSISQIKVPDDKIMV
ISIDKAGKVFFGVDAQPTRAAMLDNIGQAKGITFTDAEKAKFALQSSFGLPLNQLKPWLN
MPKEQMSQVKQPGIPVDSTGASELADWVYAARKADSQLRIALKGDNLSKFPAFKDVLANL
QSQNINKFNLITGSEQAPAGYTND
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtaaggcctaagaaacatgcgccgcatactgatatgacggcgatgacggat
gtggcgttcttgctcttgacgttcttcattatgacggcgacttttaagtcgaacgatgca
gagattacaacacctacatcgatttcgcagatcaaagtgccagatgataagattatggtc
atcagcattgacaaagcagggaaagtgttctttggtgtggatgcccagcccactcgcgct
gcgatgctggacaacattggccaggccaagggcattacattcactgatgctgagaaggcg
aagtttgcactgcagtcaagctttggtttacctctcaatcagctgaaaccctggttgaac
atgccgaaagagcaaatgagccaggtgaagcaaccaggtatcccggttgactccacaggc
gccagcgaattggcagactgggtttatgctgcgcggaaagcagacagccaactacgtatt
gcattgaaaggcgacaacctgtcgaagttccctgcattcaaagacgtactggcaaacctg
caatcgcagaatatcaacaagttcaacctgattacaggtagcgagcaagcaccagccggt
tacacaaacgattaa

DBGET integrated database retrieval system