KEGG   Dyadobacter fermentans: Dfer_4328Help
Entry
Dfer_4328         CDS       T00970                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00010  Glycolysis / Gluconeogenesis
dfe00052  Galactose metabolism
dfe00500  Starch and sucrose metabolism
dfe00520  Amino sugar and nucleotide sugar metabolism
dfe00521  Streptomycin biosynthesis
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dfe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_4328
   00052 Galactose metabolism
    Dfer_4328
   00500 Starch and sucrose metabolism
    Dfer_4328
   00520 Amino sugar and nucleotide sugar metabolism
    Dfer_4328
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dfer_4328
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dfer_4328
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dfer_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACT95530
UniProt: C6W1V5
Position
5251753..5252583
Genome map
AA seq 276 aa AA seqDB search
MNIGVDIGGTNIRAGIESGGHITRQNQTLLANKHSLSATLDQLMDVIRPLTAFPVKGIGI
GVPSVVDISKGIVYNVLNIPSWEEVALRDIVEKEFNLPVSVNNDVNCFVLGEHRFGLARK
FRSVIGMAIGTGLGSGIIIDNHLYAGKNCGAGEIGMLPYKDSVLENYVCNRFFEDSLGID
AYAAHEAALQGNRKAIEVWEEFGVHLGAVIKAIMYTYDPEAIVMGGSIAQANRFFQESML
ESIQDFAYPESLKKLTLLISENKNIALLGAAALLGD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacattggtgtagatatcggtggcacgaacatccgtgccggtatcgaatcgggtggc
catattacccggcaaaatcagacattactggccaacaaacattcgctgtcggcaacgctc
gaccaactgatggacgtcatacgtccgttgacggcctttcccgtaaagggcatcggaatc
ggtgtgccgtcggtggtggatattagcaagggcattgtgtacaacgtgctgaacatccct
tcgtgggaggaagttgcgctgcgcgatattgtggaaaaggagttcaatctgccggtttcg
gtgaacaacgatgtgaattgcttcgtcctcggcgagcatcggttcgggctggcgcggaaa
ttccggtcggtgatcgggatggcaatcggtacggggctgggctcgggcattatcatcgac
aatcatttgtacgcaggcaagaactgcggcgccggcgagatcgggatgctgccctacaag
gattcggtgctcgaaaattacgtctgcaaccgttttttcgaagattcactcggcatagac
gcctatgcggcgcacgaggcggccttgcaggggaataggaaggcgatcgaagtatgggag
gaatttggcgtgcatttgggagcggtgatcaaggcgattatgtacacctacgatcccgaa
gccatcgtgatgggtggctccattgcccaggccaaccggtttttccaggaaagtatgctg
gaaagtatccaggatttcgcttatcccgagtctttgaagaagttgacattgctgatatcc
gaaaacaaaaacatcgctttgctcggtgcggcagcattgctgggcgattga

DBGET integrated database retrieval system