KEGG   Dyadobacter fermentans: Dfer_4539Help
Entry
Dfer_4539         CDS       T00970                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00020  Citrate cycle (TCA cycle)
dfe00620  Pyruvate metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Module
dfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_4539
   00620 Pyruvate metabolism
    Dfer_4539
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Dfer_4539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACT95740
UniProt: C6W3P2
Position
complement(5475729..5477255)
Genome map
AA seq 508 aa AA seqDB search
MNTKKSSKTSSPDVVLIGAGIMSATLGVLLKKLNPAITISVFERLDRVTAESSDPWNNAG
TGHSAFCELNYTPQLADGSIETKKAIKIAESFEVSKEFWAYLVENGVIDSPDAFIHNIPH
LSFVWGEENVDYLRKRYEALTSHHLFHGMEYTEDKDVIANWAPLVMNGRGADEKVAATRM
ELGTDVNFGALTKAMFEYLEKQDGVNLFLNYEVDDLTRKKDNSWLIEVKDRATRKESKVT
AKFVFIGAGGGSLPLLEKSNIPEGKGFGGFPVSGQWLVCNKPEIIEKHQAKVYGKASVGS
PPMSVPHLDTRVIDGKKALLFGPYAGFSTKFLKNGSYLDLPLSIKLNNIKPMLAAGLHNI
PLTKYLIDQVRQSPQDRLQALKDYFPEAKLEDWDLETAGQRVQVIKKDKKAGGVLEFGTE
MVTAGDGSLAALLGASPGASTAVSIMLDLIHRCFAEAKTPEWQREFKKIIPSFGKSLSKE
KELAAKTRAWTTEVLHLSASHLEAEMTA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaaaaagtcttcaaaaacgagctcacctgacgtggttttgattggggcaggc
attatgagcgctacgctcggggttctactaaaaaagcttaatccggccattaccatttcc
gtgttcgaacgtctggaccgcgtcactgcggagagctccgatccctggaataatgccggc
accggccattccgcattttgcgaactgaactacacgccgcaacttgccgacggttccatc
gaaaccaaaaaagcgattaagatcgccgagtctttcgaagtttcgaaggaattttgggcg
tatcttgtagagaatggcgtgattgattcgcctgatgcttttatccacaacattccccac
ctgagctttgtgtggggcgaggaaaacgtggattatctacgcaaacgttacgaggccttg
acgagccaccacctttttcacggaatggaatacaccgaggataaggatgtgatcgccaac
tgggccccgcttgtgatgaacggtcgcggtgccgatgaaaaagttgccgctacccgcatg
gagctgggcaccgacgtcaacttcggcgcgcttactaaggcgatgttcgaatatcttgaa
aaacaggatggcgtcaatctcttcctgaactatgaggttgatgacctgacgcgcaaaaaa
gacaattcgtggctgattgaagtgaaggaccgcgcgacccggaaagagagcaaggttact
gcgaaattcgtattcatcggtgcaggcggaggctccttaccactgctcgaaaaatcaaat
attcccgaaggaaaaggctttggcggcttcccggtgagcggacaatggctcgtgtgtaac
aagccggagatcatcgaaaaacaccaggcgaaagtgtatggcaaggcctctgtgggatcg
cctccgatgtcggttccacacttggatacccgggttatagatggtaaaaaagcgcttcta
ttcgggccatatgccggtttttcaacgaagttcctgaaaaatggctcctatctcgacctt
ccgctttccattaagctgaataatatcaaaccgatgctggcagctggcctgcataacatc
ccgctgaccaaatatctgatcgatcaggtaagacagtcgcctcaggacaggctccaagcc
ctgaaagattatttcccggaagcgaaactggaagattgggatctggaaacggccggccag
cgcgtgcaggtgatcaaaaaagacaaaaaagcgggcggagtgctcgaattcgggaccgaa
atggttaccgcaggcgacggctcactcgctgcattgctgggtgcgtctccgggtgcttcc
acagcggtgtcgatcatgctcgacctgattcaccgttgctttgcagaagccaaaacgccg
gaatggcagcgtgaattcaagaaaatcatcccttcattcggaaagtcactttccaaagag
aaggagctcgccgcaaaaacccgcgcctggactaccgaagtgctccatttgagcgcctcg
catctggaagcagaaatgactgcgtag

DBGET integrated database retrieval system