KEGG   Dyadobacter fermentans: Dfer_4625Help
Entry
Dfer_4625         CDS       T00970                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00040  Pentose and glucuronate interconversions
dfe00052  Galactose metabolism
dfe00500  Starch and sucrose metabolism
dfe00520  Amino sugar and nucleotide sugar metabolism
dfe01100  Metabolic pathways
dfe01130  Biosynthesis of antibiotics
Module
dfe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dfer_4625
   00052 Galactose metabolism
    Dfer_4625
   00500 Starch and sucrose metabolism
    Dfer_4625
   00520 Amino sugar and nucleotide sugar metabolism
    Dfer_4625
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dfer_4625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACT95826
UniProt: C6W3X8
Position
complement(5587802..5588665)
Genome map
AA seq 287 aa AA seqDB search
MIRKAVIPAAGLGTRFLPATKSMPKEMLPIIDIPTIQYVVQEAVDSGIEDILIISGKGKR
AIEDHFDRNVELESRLEEKEDLLWFNEMRRLADMANVHFVRQKEANGLGDAIYYARHHVG
NEPFAVLLGDTIMDSVIPVTQQLMDTYEQYGGSVIAVEEVPANKVNRYGIVGGNSLSDSI
LELSTLVEKPAIDKAPSNLAIAGRYVLTPEIFNTIEQTPKGKNNEIQLTDSLLLLLKREN
IFAHHIEGKRHDIGDKLDYLKTTVEFALKRKEFAEPFRKFLVDILNK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtaaagccgttatacctgccgccgggcttgggacccgattcctgccggcaacc
aagtcgatgccgaaggaaatgcttccgattatcgacattcctaccattcaatacgtagtg
caggaagccgttgactcggggattgaagatatcctgatcatttccgggaaaggaaagcgg
gctatcgaggaccatttcgatcgcaatgtggaactcgaaagtcgcctcgaagaaaaggaa
gatctcctttggttcaatgaaatgcgccgtttggcagacatggccaatgtgcatttcgta
cggcagaaagaagccaacggcctcggcgacgccatttactatgcgcgtcaccacgttggt
aatgagccatttgcggtacttttgggcgataccatcatggattcggtgattccggtgacc
cagcagctgatggacacgtatgaacaatacggcggctcggtgatcgcggtggaggaagtg
cctgccaataaagtaaaccgttacggcatcgtaggcggtaactcactcagcgactccatc
ctcgaactgagcacattagtcgaaaagccggctatcgacaaggcaccttccaacctggcc
attgccggccggtatgtgctcacgcccgaaatttttaacaccatcgagcagacgcccaaa
ggcaagaacaacgaaatccaactcaccgactcgctgttgctgcttttgaaacgcgaaaat
attttcgcacaccatatcgaaggcaagcgccacgatatcggcgacaagctggattacctc
aaaacaaccgtcgagtttgcattgaaaagaaaggaatttgctgaaccattccggaaattc
ctcgttgatatcctgaacaaatag

DBGET integrated database retrieval system