KEGG   Dyadobacter fermentans: Dfer_5646Help
Entry
Dfer_5646         CDS       T00970                                 

Definition
(GenBank) cytochrome bd ubiquinol oxidase subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00190  Oxidative phosphorylation
dfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_5646
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dfer_5646
Enzymes [BR:dfe01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     Dfer_5646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II
Motif
Other DBs
NCBI-ProteinID: ACT96836
UniProt: C6VWT6
Position
complement(6783884..6784909)
Genome map
AA seq 341 aa AA seqDB search
MLYIVITYLWASILLYLLLGGADFGAGIIELFTSQKNKQVTRKTLYSAIGPIWEANHMWL
IIAIVILFVGFPVIYSTMSVNLHIPLTVMLIGIIARGTAFTFRHYDAVVDDMQHLYNTIF
AVSSFITPLFLGIIAGSAVSGHIDPSARSFADAYIFSWLHWFAITVGLFTVSICGFLASV
YLIGETKVEHERLRFAHKAQFFNIAAVVCGALVFVAAWFEHIPLIDWVFGNWIGRIAILS
ATLSLIWMWTLLYQGKIRLLRPLAGFQVTMILLTTTFRHFPNIVVLKGGGYLSLTEHAGH
EKTVEALGWALLLGSILILPALFYLIYSFQKKPLAYGGEGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctctacatcgtcatcacatacctctgggcgtcgattttgctttacctgctgctgggt
ggagcggattttggcgcgggcattattgagctctttacttcgcaaaaaaacaagcaggtt
acccgcaaaacgctctattcagccatcgggccgatttgggaggctaaccacatgtggctc
atcattgccatcgtgattttgttcgttgggtttccggtcatctattctaccatgtctgtc
aacctgcatattccgctcacggtcatgctcatcggcatcatcgcgcgcgggacggcgttc
acgttccggcattacgatgccgtggtggacgatatgcagcatctttataacaccattttc
gccgtttcgagcttcattacgccgcttttcctgggcattatcgccggaagcgccgtttcg
gggcacatcgatccttccgccaggtcctttgccgatgcctacattttcagctggttgcat
tggttcgccattacggtggggctgttcaccgtttcgatctgcgggtttctggcgtcggtt
tacctcatcggcgagaccaaggtggagcacgagcgcctgcgttttgcccataaggcgcaa
tttttcaatatcgcggcggtggtatgcggcgcgctggtgtttgtggcagcgtggtttgag
catattccgttgatcgactgggtgttcggcaactggatcggacggattgcgatcctttcc
gccacgctgtcgctgatctggatgtggacgttgctctatcaaggcaaaatacgtctgctt
cgcccgctggccggtttccaggtgacgatgatcctgctaacgaccactttcaggcatttt
cccaacatcgtggtcctgaaaggcggcggttacctgtcgctcaccgagcacgcgggccac
gaaaaaaccgtcgaagccctcggctgggcattgcttttgggcagcatattgatcttaccg
gcgcttttctacctgatttacagctttcaaaagaaaccgctggcctatggcggcgagggg
cattga

DBGET integrated database retrieval system