KEGG   Desulfotomaculum ferrireducens: B0537_13675Help
Entry
B0537_13675       CDS       T04823                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dfg  Desulfotomaculum ferrireducens
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B0537_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AQS60028
UniProt: A0A1S6IZ31
Position
2785935..2786933
Genome map
AA seq 332 aa AA seqDB search
MDQHIIIIAVVILALSFDFINGFHDTANSIATAISTKALKPAYAIMLAASMNLIGALTFT
GVAKTVGGKVANPANIEHGVYVVAAALIAAIAWNLFTWYYGIPSSSSHALIGSLAGAVIA
AAGISAVNLAGFLSIVESLILSPLLAFTVGYIIMSLIRLIFANFSPHKINSRFRSLQVLT
AAFQSFSHGTNDAQKTMGIITFALVAGGYQSTVEVQTWVKVSAAVAMALGTSVGGWRIIK
TIGTKIIKFEPASGFAADLSSALVIISATLFKLPVSTTHVISSAIMGVGSAKRFSSVQWG
TAVTMVSAWIITLPVTMVLAGFTFIIVRFLFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacatattattatcattgccgtggtgatactggctttaagttttgacttcatt
aacggttttcatgatactgctaattctattgccaccgctatttctaccaaagccttaaaa
ccggcctatgccatcatgctagctgcttccatgaacttgattggcgccttaacctttaca
ggggtagctaaaactgtcggtggtaaagtggccaaccccgctaatattgaacacggtgtt
tatgtggtggcagctgcccttattgctgccattgcttggaacctgtttacctggtattat
ggcattcccagtagttcctcccacgccctaattgggtctttagccggggcggtaatagcc
gccgcaggtattagtgctgttaacttagctggctttttgagcattgtggaaagcctgatc
ctatcaccgttactggcatttaccgttggttacattattatgtcactcattcggctaata
ttcgcaaatttttcacctcacaaaataaactcccggtttcgttccctacaggtactcact
gcggccttccaatcctttagccacggcaccaatgatgctcagaaaaccatgggcatcatt
acctttgctctggtggccggtgggtatcagtctacagtggaggtacaaacctgggtcaag
gtttcggcagcggtggccatggccttgggtacctctgtggggggctggcgaattattaaa
accattggcaccaagattattaagtttgaaccggctagcggttttgccgcggatttaagc
tctgccctggttattattagtgctactttgtttaaactaccggtttccaccacccacgtt
attagctcggctattatgggtgtgggttctgctaaaagattctcctctgttcagtggggt
acagcagtaacaatggtttctgcctggattattaccttaccggtgaccatggtactggca
ggcttcaccttcataattgtaagatttctcttcctgtag

DBGET integrated database retrieval system