KEGG   Desulfovibrio fairfieldensis: AXF13_01395Help
Entry
AXF13_01395       CDS       T04293                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dfi  Desulfovibrio fairfieldensis
Pathway
dfi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AXF13_01395
Enzymes [BR:dfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AXF13_01395
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AXF13_01395
    1.1.1.-  
     AXF13_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AMD91465
UniProt: A0A0X8JMG5
Position
complement(322124..323158)
Genome map
AA seq 344 aa AA seqDB search
MKAGVLTGPQRIEIRRVPVPEMAPGMLKIRISACGVCGSDIHMWKAGKGWSPEPLDNFHM
GHEFCGVVVDPGDSGFQIGDRVTFWANLYCGKCDMCRAGKEHLCRDVHGTNYIGFVCNGG
YAEYFVGKAGNAYKLPDTVSDVAAGLIDPLMVAYHAVRQSSLKLHDKVLVVGSGIIAQLI
GGLAKKAGASALAMSRIDERQTGKAREIGDFDAYFDGNDPDRAAKMQEASEGGFDVVFEA
VGAGESLAACMDGVKPGGEIVMIGNSMTPTVPFELNRAVLHEVRLTGSVSCTRKEFTETI
DLIAKGIIDAEKYVTGILPLDQLQHAFEKQISPAESVLKTVIRL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctggagtgctgaccgggccgcagcggattgaaatcaggcgggtgcccgttccg
gaaatggctccgggcatgttgaagatacggatttccgcctgcggggtgtgcggcagcgac
atccacatgtggaaggccggaaaaggctggagcccggaacccctcgacaatttccatatg
ggacatgaattttgcggcgtggtggtcgatcccggcgacagcggttttcaaatcggcgac
cgcgtgacgttctgggccaacctgtactgtggcaaatgcgatatgtgccgggcgggcaag
gaacatctttgccgggatgtgcacggcacgaattacatcggtttcgtatgcaacggcggc
tatgcggaatactttgtcggcaaggccgggaatgcctacaagctgccggatacggtgtcg
gacgtcgccgccgggctgattgaccctctgatggttgcttatcatgcggtcaggcagtcc
agtctgaaactgcacgacaaggtgctggtggtcggcagcggcattatcgcgcagcttatc
ggcggactggccaagaaggcgggagcctccgctctggccatgtccaggattgatgagagg
caaacgggcaaggcacgggaaataggcgatttcgacgcttattttgacgggaacgatccc
gatcgtgccgcaaagatgcaggaggcttccgaaggcggcttcgatgttgttttcgaggct
gtcggcgcgggagaatcccttgccgcctgcatggacggcgtgaaacccggcggcgaaata
gtgatgatcggcaactcgatgacgcctacggttccttttgaactgaaccgcgccgtgctg
catgaagtccgcctgaccgggagcgtttcctgcacccgaaaggaatttacggaaaccatt
gacctcatcgccaaaggcatcatcgacgctgaaaagtatgtgaccggcattctgccgctg
gatcagcttcagcacgctttcgagaaacagatttccccggccgaatccgttttgaagacc
gtcatcaggctgtaa

DBGET integrated database retrieval system