KEGG   Desulfovibrio fairfieldensis: AXF13_13400Help
Entry
AXF13_13400       CDS       T04293                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
dfi  Desulfovibrio fairfieldensis
Pathway
dfi00561  Glycerolipid metabolism
dfi00640  Propanoate metabolism
dfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXF13_13400 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AXF13_13400 (gldA)
Enzymes [BR:dfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AXF13_13400 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK
Motif
Other DBs
NCBI-ProteinID: AMD91036
UniProt: A0A120KMD3
Position
3181851..3182936
Genome map
AA seq 361 aa AA seqDB search
MLKLMRAPAKYIQGKDALLSTYDETKNLGKSFLFICSRSGEKACRAHLEQSFAGKEAAIR
FEIFGGHSSEGEIQRMRDIVRAHGIDCVAGVGGGSAIDTAKATAYYEGLPVLVIPTVSAT
DAPCTGLSVIYKDDGSFSKYLFYPKNPDVVLVDSTVIANAPVKFLVAGMGDALGTYFEAR
MCARAKAPSLENGGITRSALALCRLCYETLLENGARAKAAVERHLLTPDVEAIIEANIYL
SGVGADNGGLCVAHSVYNGFTALEECTAAHGSVVAFGTIVQLLLENAPGAELRQVQDFCL
NVGLPVTLAEMGVTDPARVAVAATKACAPGESIHNMIGDVTPEELTDAVLAADGLGRALR
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactgatgcgggcacccgcaaaatatatccagggcaaggacgccctgctttcc
acgtatgacgaaaccaaaaatctgggcaaatccttcctcttcatctgcagccgcagcggt
gaaaaggcctgccgcgcccacctggagcaaagttttgccggcaaggaggccgccatccgc
ttcgagattttcggcggacacagctccgagggcgaaattcaacgcatgcgcgacatcgtg
cgcgctcacggcattgactgcgtggccggtgtgggcggcggctcggccatcgacacggcc
aaggccacggcctattacgaaggcctgcccgtgctggtcattcccactgtcagcgccacg
gacgcgccctgcaccgggctttcggtcatctacaaggatgacggctcgttcagcaaatac
cttttctatccgaaaaatcccgacgtggttctggtggattcaacggtcatcgccaacgcg
ccggtcaaattcctggtggcgggcatgggcgacgccctgggcacctatttcgaagcccgg
atgtgcgccagagccaaagcccccagcctggaaaacggcggcatcacccgttcggccctg
gccctctgccgcctctgctacgaaaccctgctggaaaacggcgcacgggccaaggccgcc
gtggagcggcatctgctcaccccggatgtggaggcgatcattgaggccaatatctacctc
tcgggcgtgggcgcggacaacggcggcctgtgcgtggcccactccgtgtacaacggcttc
accgccctggaagaatgcacggcggcccacggcagcgtggtggccttcggcaccatcgtg
caactgttgctggaaaacgcgcccggcgcggaactgcgccaggtgcaggacttctgtctg
aatgtgggcctgcccgtgaccctggcggaaatgggcgtcaccgaccccgcgcgggtggcc
gtggccgccacgaaggcctgcgcgccgggcgaaagcatccacaacatgatcggcgacgtc
acgccggaggaactgaccgacgccgttctggcggcggacggcctgggccgcgccctgcgc
gcctga

DBGET integrated database retrieval system