KEGG   Desulfovibrio ferrophilus: DFE_3205Help
Entry
DFE_3205          CDS       T05829                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dfl  Desulfovibrio ferrophilus
Brite
KEGG Orthology (KO) [BR:dfl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DFE_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4157
Motif
Other DBs
NCBI-ProteinID: BBD09931
UniProt: A0A2Z6B366
Position
3479234..3480469
Genome map
AA seq 411 aa AA seqDB search
MDLYDLFFLLSLGAGFLMAFNLGANDVANSMASAVGARAITVKQAVFIAGILNFVGAVFL
GSHVTATVSKGIINPAMISDPKLIMLGMFGALLAAGIWVLIATLTALPVSSTHSIVGAIL
GFGLVAGGPDVVNWLKLGGVVLSWFISPFLAAGIAYFIFTQIRRDIFLKPNFLENARKYG
PRWMALTMTLVGFSFMYKTPVGKQLALVWYESLALISLLSLGVWLVSSRMALRMSLTVED
GAEGVEAIFRKMQIFTSCYVALSQGANDVANAIGPIAAIYVLAKQGTFLTQAEVPIWLLA
LGGAGIALGIAVLGHKVMRTVGESITTLTNTRGFAVDFAAATTVLVASKLGLPVSTTHAA
VGGVTGVGLARGFKAVNFGVLGKIVVYWLLTVPIAAFTSIVIFQILKWSVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggatttatacgacttgtttttcttgctgtccctaggggcagggttcctgatggcgttc
aacctcggggccaatgatgtggcaaactccatggcttcggctgttggagcgcgcgccatc
accgtcaagcaggcggtgttcatcgctggcatcctgaactttgtcggagcggtttttctg
gggtcccacgtcacggccacggtcagcaaggggatcatcaacccggccatgatatccgat
cccaagttgattatgcttggaatgttcggagcgctgttggccgcggggatatgggtcctc
atcgccacgctgacggctttgccggtctcgagtacacactccattgtcggagccatcctt
ggctttgggttggttgcgggtggtccggatgtggtcaactggctcaagttgggcggggtg
gtactgtcatggttcatctccccgttccttgctgcaggtatcgcgtatttcatcttcacc
cagattcgcagggatatcttcctcaagccgaattttttggaaaatgcgcgtaagtatggc
ccgcgttggatggccctgaccatgaccctggtcggtttttccttcatgtataagacccct
gtcggaaagcagctggccttggtctggtacgagtcgctggcgttgattagcttactgtct
cttggcgtttggctggtttcatcccgaatggccctgcgcatgtcgctgacggtcgaggat
ggtgccgaaggcgtggaggcaatcttccgcaagatgcagatctttacctcctgctatgtg
gcgttgtcccagggtgccaacgatgtggccaacgccatcgggcccattgccgccatctat
gtgctggccaagcaagggaccttcctgacacaggccgaggtccccatctggttgctggct
ttgggcggggcagggattgccctcggtatcgctgtgcttgggcataaggtgatgcggaca
gtgggtgaaagcatcaccactttgaccaatacgcgtggctttgctgtcgattttgctgca
gcgacgacagtgcttgtggcttcaaagcttggcctgcccgtttcaaccactcacgcggca
gtgggtggcgtgaccggtgtgggattggcaagaggtttcaaagccgttaactttggagtg
ttgggcaagatcgtcgtctattggctgctgacggtgcctattgctgcgttcacatccatt
gtcatttttcagatactcaaatggtcggtctattaa

DBGET integrated database retrieval system